Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A FIVE SITE MUTATED CYANOVIRIN-N
 
Authors :  R. Fromme, Z. Katilene, P. Fromme, G. Ghirlanda
Date :  17 May 07  (Deposition) - 31 Jul 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Cyanovirin-N, Sugar Binding Protein, Anti-Hiv, Gp120 (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Fromme, Z. Katiliene, B. Giomarelli, F. Bogani, J. M. Mahon, T. Mori, P. Fromme, G. Ghirlanda
A Monovalent Mutant Of Cyanovirin-N Provides Insight Into The Role Of Multiple Interactions With Gp120 For Antiviral Activity.
Biochemistry V. 46 9199 2007
PubMed-ID: 17636873  |  Reference-DOI: 10.1021/BI700666M
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYANOVIRIN-N
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: M51
    Expression System Taxid: 562
    Gene: CYANOVIRIN-N
    Mutation: YES
    Organism Scientific: NOSTOC ELLIPSOSPORUM
    Organism Taxid: 45916
    Synonym: CV-N

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2Z21)

(-) Sites  (0, 0)

(no "Site" information available for 2Z21)

(-) SS Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1A:8 -A:22
2A:58 -A:73
3B:8 -B:22
4B:58 -B:73

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2Z21)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2Z21)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2Z21)

(-) Exons   (0, 0)

(no "Exon" information available for 2Z21)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:102
 aligned with CVN_NOSEL | P81180 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:102
                                                                                                                              101 
                                    10        20        30        40        50        60        70        80        90       100| 
            CVN_NOSEL     1 LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE-   -
               SCOP domains d2z21a_ A: automated matches                                                                           SCOP domains
               CATH domains 2z21A00 A:1-102 HIV-inactivating Protein,Cyanovirin-n;                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhheeeeeee..eeeeeee.....eeeeeee.hhh.eee..eee....hhhh.eeeeeee...eeeeeee.....eeeeeee....eeee..eeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------ Transcript
                 2z21 A   1 LGNFSQACYNSAIQGSVLTSTCIRTNGGYNTSSIDLNSVIENVDGSLKWQGSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIAAIDGTLKYEL 102
                                    10        20        30        40        50        60        70        80        90       100  


Chain B from PDB  Type:PROTEIN  Length:102
 aligned with CVN_NOSEL | P81180 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:102
                                                                                                                             101  
                                    11        21        31        41        51        61        71        81        91       101  
            CVN_NOSEL     2 GKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE--   -
               SCOP domains d2z21b_ B: automated matches                                                                           SCOP domains
               CATH domains 2z21B00 B:2-103 HIV-inactivating Protein,Cyanovirin-n;                                                 CATH domains
           Pfam domains (1) -CVNH-2z21B01 B:3-100                                                                              --- Pfam domains (1)
           Pfam domains (2) -CVNH-2z21B02 B:3-100                                                                              --- Pfam domains (2)
         Sec.struct. author .hhhh.eeeeeee..eeeeeee.....eeeeeee....eeee..eeee...hhhh.eeeeeee...eeeeeee.....eeeeeee....eeee..eeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------ Transcript
                 2z21 B   2 GNFSQACYNSAIQGSVLTSTCIRTNGGYNTSSIDLNSVIENVDGSLKWQGSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIAAIDGTLKYELE 103
                                    11        21        31        41        51        61        71        81        91       101
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: CVNH] (11)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (CVN_NOSEL | P81180)
molecular function
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
biological process
    GO:0050688    regulation of defense response to virus    Any process that modulates the frequency, rate or extent of the antiviral response of a cell or organism.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2z21)
 
  Sites
(no "Sites" information available for 2z21)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2z21)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2z21
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CVN_NOSEL | P81180
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CVN_NOSEL | P81180
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CVN_NOSEL | P81180: 1iiy 1j4v 1l5b 1l5e 1lom 1n02 2ezm 2ezn 2pys 2rdk 2rp3 3czz 3ezm 3gxy 3gxz 3lhc 3s3y 3s3z 4j4c 4j4d 4j4e 4j4f 4j4g

(-) Related Entries Specified in the PDB File

1iiy NMR WITH MANNOSE MONOMER
1l5e NMR
1lom DOMAIN-SWAP-DIMER
1m5m MAN9 RES 2.5 A
2ezm NMR
2pys WITH MANNOSE(DIMER)