|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
( #: chains that contain no standard or modified protein/DNA/RNA residue)
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 4)
Asymmetric/Biological Unit (1, 4)
|
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (4, 4)
Asymmetric/Biological Unit
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2PYS) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2PYS) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2PYS) |
Exons (0, 0)| (no "Exon" information available for 2PYS) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:101 aligned with CVN_NOSEL | P81180 from UniProtKB/Swiss-Prot Length:101 Alignment length:101 101 11 21 31 41 51 61 71 81 91 101 CVN_NOSEL 2 GKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE- - SCOP domains d2pysa_ A: automated matches SCOP domains CATH domains 2pysA00 A:2-102 HIV-inactivating Protein,Cyanovirin-n; CATH domains Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------- Transcript 2pys A 2 GNFSQACYNSAIQGSVLTSTCIRTNGGYNTSSIDLNSVIENVDGSLKWQGSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIAAIDGTLKYEL 102 11 21 31 41 51 61 71 81 91 101 Chain B from PDB Type:PROTEIN Length:103 aligned with CVN_NOSEL | P81180 from UniProtKB/Swiss-Prot Length:101 Alignment length:103 101 11 21 31 41 51 61 71 81 91 101 CVN_NOSEL 2 GKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE--- - SCOP domains d2pysb_ B: automated matches SCOP domains CATH domains 2pysB00 B:2-104 HIV-inactivating Protein,Cyanovirin-n; CATH domains Pfam domains (1) -CVNH-2pysB01 B:3-100 ---- Pfam domains (1) Pfam domains (2) -CVNH-2pysB02 B:3-100 ---- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 2pys B 2 GNFSQACYNSAIQGSVLTSTCIRTNGGYNTSSIDLNSVIENVDGSLKWQGSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIAAIDGTLKYELEH 104 11 21 31 41 51 61 71 81 91 101
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (CVN_NOSEL | P81180)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|