|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 5)| Asymmetric Unit (2, 5) Biological Unit 1 (1, 6) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3LHC) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3LHC) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3LHC) |
Exons (0, 0)| (no "Exon" information available for 3LHC) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:100 aligned with CVN_NOSEL | P81180 from UniProtKB/Swiss-Prot Length:101 Alignment length:101 10 20 30 40 50 60 70 80 90 100 CVN_NOSEL 1 LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE 101 SCOP domains d3lhca_ A: automated matches SCOP domains CATH domains ----------------------------------------------------------------------------------------------------- CATH domains Pfam domains --CVNH-3lhcA01 A:3-99 - - Pfam domains
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3LHC) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (CVN_NOSEL | P81180)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|