|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1L5E) |
Sites (0, 0)| (no "Site" information available for 1L5E) |
SS Bonds (4, 4)
NMR Structure
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1L5E) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1L5E) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1L5E) |
Exons (0, 0)| (no "Exon" information available for 1L5E) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:101 aligned with CVN_NOSEL | P81180 from UniProtKB/Swiss-Prot Length:101 Alignment length:101 10 20 30 40 50 60 70 80 90 100 CVN_NOSEL 1 LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE 101 SCOP domains d1l5ea_ A: Cyanovirin-N SCOP domains CATH domains 1l5eA00 A:1-101 HIV-inactivating Protein,Cyanovirin-n; CATH domains Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------- Transcript 1l5e A 1 LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE 101 10 20 30 40 50 60 70 80 90 100 Chain B from PDB Type:PROTEIN Length:101 aligned with CVN_NOSEL | P81180 from UniProtKB/Swiss-Prot Length:101 Alignment length:101 10 20 30 40 50 60 70 80 90 100 CVN_NOSEL 1 LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE 101 SCOP domains d1l5eb_ B: Cyanovirin-N SCOP domains CATH domains 1l5eB00 B:102-202 HIV-inactivating Protein,Cyanovirin-n; CATH domains Pfam domains (1) --CVNH-1l5eB01 B:104-201 - Pfam domains (1) Pfam domains (2) --CVNH-1l5eB02 B:104-201 - Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------- Transcript 1l5e B 102 LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE 202 111 121 131 141 151 161 171 181 191 201
|
||||||||||||||||||||
SCOP Domains (1, 2)
NMR Structure
|
CATH Domains (1, 2)| NMR Structure |
Pfam Domains (1, 2)
NMR Structure
|
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A,B (CVN_NOSEL | P81180)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|