Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF HUMAN POLYCOMB REPRESSIVE COMPLEX 2 (PRC2) WITH ONCOGENIC HISTONE H3K27M PEPTIDE
 
Authors :  Y. Zhang, N. Justin, J. R. Wilson, S. J. Gamblin
Date :  01 Feb 16  (Deposition) - 11 May 16  (Release) - 11 May 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.95
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,O,P,Q,R,S,T,U
Biol. Unit 1:  A,B,C,D,E  (1x)
Biol. Unit 2:  F,G,H,I,J  (1x)
Biol. Unit 3:  K,L,M,O,P  (1x)
Biol. Unit 4:  Q,R,S,T,U  (1x)
Biol. Unit 5:  A,B,C,D  (1x)
Biol. Unit 6:  F,G,H,I  (1x)
Biol. Unit 7:  K,L,M,O  (1x)
Biol. Unit 8:  Q,R,S,T  (1x)
Keywords :  Chromatin Modification Complex, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  N. Justin, Y. Zhang, C. Tarricone, S. R. Martin, S. Chen, E. Underwood, V. De Marco, L. F. Haire, P. A. Walker, D. Reinberg, J. R. Wilson, S. J. Gamblin
Structural Basis Of Oncogenic Histone H3K27M Inhibition Of Human Polycomb Repressive Complex 2.
Nat Commun V. 7 11316 2016
PubMed-ID: 27121947  |  Reference-DOI: 10.1038/NCOMMS11316

(-) Compounds

Molecule 1 - HISTONE-LYSINE N-METHYLTRANSFERASE EZH2
    Chains: A, F, K, Q
    EC Number: 2.1.1.43
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: EZH2, KMT6
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: ENX-1,ENHANCER OF ZESTE HOMOLOG 2,LYSINE N-METHYLTRANSFERASE 6
 
Molecule 2 - POLYCOMB PROTEIN EED
    Chains: B, G, L, R
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: EED
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: HEED,WD PROTEIN ASSOCIATING WITH INTEGRIN CYTOPLASMIC TAILS 1,WAIT-1
 
Molecule 3 - POLYCOMB PROTEIN SUZ12
    Chains: C, H, M, S
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: SUZ12, CHET9, JJAZ1, KIAA0160
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CHROMATIN PRECIPITATED E2F TARGET 9 PROTEIN,CHET 9 PROTEIN, JOINED TO JAZF1 PROTEIN,SUPPRESSOR OF ZESTE 12 PROTEIN HOMOLOG
 
Molecule 4 - H3K27M
    Chains: D, I, O, T
    Engineered: YES
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synthetic: YES
 
Molecule 5 - JARID2 K116ME3
    Chains: E, J, P, U
    Engineered: YES
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synthetic: YES

 Structural Features

(-) Chains, Units

  1234567891011121314151617181920
Asymmetric Unit : ABCDEFGHIJKLMOPQRSTU
Biological Unit 1 (1x): ABCDE               
Biological Unit 2 (1x):      FGHIJ          
Biological Unit 3 (1x):           KLMOP     
Biological Unit 4 (1x):                QRSTU
Biological Unit 5 (1x): ABCD                
Biological Unit 6 (1x):      FGHI           
Biological Unit 7 (1x):           KLMO      
Biological Unit 8 (1x):                QRST 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 40)

Asymmetric Unit (3, 40)
No.NameCountTypeFull Name
1M3L4Mod. Amino AcidN-TRIMETHYLLYSINE
2SAH4Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
3ZN32Ligand/IonZINC ION
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
1M3L1Mod. Amino AcidN-TRIMETHYLLYSINE
2SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
3ZN-1Ligand/IonZINC ION
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
1M3L1Mod. Amino AcidN-TRIMETHYLLYSINE
2SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
3ZN-1Ligand/IonZINC ION
Biological Unit 3 (2, 2)
No.NameCountTypeFull Name
1M3L1Mod. Amino AcidN-TRIMETHYLLYSINE
2SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
3ZN-1Ligand/IonZINC ION
Biological Unit 4 (2, 2)
No.NameCountTypeFull Name
1M3L1Mod. Amino AcidN-TRIMETHYLLYSINE
2SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
3ZN-1Ligand/IonZINC ION
Biological Unit 5 (1, 1)
No.NameCountTypeFull Name
1M3L-1Mod. Amino AcidN-TRIMETHYLLYSINE
2SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
3ZN-1Ligand/IonZINC ION
Biological Unit 6 (1, 1)
No.NameCountTypeFull Name
1M3L-1Mod. Amino AcidN-TRIMETHYLLYSINE
2SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
3ZN-1Ligand/IonZINC ION
Biological Unit 7 (1, 1)
No.NameCountTypeFull Name
1M3L-1Mod. Amino AcidN-TRIMETHYLLYSINE
2SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
3ZN-1Ligand/IonZINC ION
Biological Unit 8 (1, 1)
No.NameCountTypeFull Name
1M3L-1Mod. Amino AcidN-TRIMETHYLLYSINE
2SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
3ZN-1Ligand/IonZINC ION

(-) Sites  (42, 42)

Asymmetric Unit (42, 42)
No.NameEvidenceResiduesDescription
01AC1SOFTWARECYS A:286 , CYS A:289 , CYS A:294 , HIS A:297binding site for residue ZN A 1001
02AC2SOFTWARECYS A:320 , CYS A:324 , CYS A:452 , CYS A:463binding site for residue ZN A 1002
03AC3SOFTWARECYS A:530 , CYS A:543 , CYS A:549 , CYS A:553binding site for residue ZN A 1003
04AC4SOFTWARECYS A:523 , HIS A:525 , CYS A:530 , CYS A:534binding site for residue ZN A 1004
05AC5SOFTWARECYS A:523 , CYS A:536 , CYS A:543 , CYS A:547binding site for residue ZN A 1005
06AC6SOFTWARECYS A:560 , CYS A:566 , CYS A:580 , CYS A:588 , CYS A:601 , ZN A:1007 , ZN A:1008binding site for residue ZN A 1006
07AC7SOFTWARECYS A:560 , CYS A:573 , CYS A:580 , CYS A:585 , ZN A:1006 , ZN A:1008binding site for residue ZN A 1007
08AC8SOFTWARECYS A:560 , CYS A:562 , CYS A:566 , CYS A:571 , ZN A:1006 , ZN A:1007binding site for residue ZN A 1008
09AC9SOFTWAREVAL A:621 , ALA A:622 , GLY A:623 , TRP A:624 , MET A:662 , CYS A:663 , SER A:664 , PHE A:665 , PHE A:686 , ALA A:687 , ASN A:688 , HIS A:689 , TYR A:726 , LEU A:734 , TYR A:736binding site for residue SAH A 1009
10AD1SOFTWARECYS F:286 , CYS F:289 , CYS F:294 , HIS F:297binding site for residue ZN F 1001
11AD2SOFTWARECYS F:320 , CYS F:324 , CYS F:452 , CYS F:463binding site for residue ZN F 1002
12AD3SOFTWARECYS F:530 , CYS F:543 , CYS F:549 , CYS F:553binding site for residue ZN F 1003
13AD4SOFTWARECYS F:523 , HIS F:525 , CYS F:530 , CYS F:534binding site for residue ZN F 1004
14AD5SOFTWARECYS F:523 , CYS F:536 , CYS F:543 , CYS F:547binding site for residue ZN F 1005
15AD6SOFTWARECYS F:566 , CYS F:580 , CYS F:588 , CYS F:601binding site for residue ZN F 1006
16AD7SOFTWARECYS F:560 , CYS F:573 , CYS F:580 , CYS F:585 , ZN F:1008binding site for residue ZN F 1007
17AD8SOFTWARECYS F:560 , CYS F:562 , CYS F:566 , CYS F:571 , ZN F:1007binding site for residue ZN F 1008
18AD9SOFTWAREVAL F:621 , ALA F:622 , GLY F:623 , TRP F:624 , MET F:662 , CYS F:663 , SER F:664 , PHE F:665 , PHE F:686 , ASN F:688 , HIS F:689 , TYR F:726 , ALA F:733 , LEU F:734 , TYR F:736binding site for residue SAH F 1009
19AE1SOFTWARECYS K:286 , CYS K:289 , CYS K:294 , HIS K:297binding site for residue ZN K 1001
20AE2SOFTWARECYS K:320 , CYS K:324 , CYS K:452 , CYS K:463binding site for residue ZN K 1002
21AE3SOFTWARECYS K:530 , CYS K:543 , CYS K:549 , CYS K:553binding site for residue ZN K 1003
22AE4SOFTWARECYS K:523 , HIS K:525 , CYS K:530 , CYS K:534binding site for residue ZN K 1004
23AE5SOFTWARECYS K:523 , CYS K:536 , CYS K:543 , CYS K:547binding site for residue ZN K 1005
24AE6SOFTWARECYS K:566 , CYS K:580 , CYS K:588 , CYS K:601binding site for residue ZN K 1006
25AE7SOFTWARECYS K:560 , CYS K:573 , CYS K:580 , CYS K:585 , ZN K:1008binding site for residue ZN K 1007
26AE8SOFTWARECYS K:560 , CYS K:562 , CYS K:566 , CYS K:571 , ZN K:1007binding site for residue ZN K 1008
27AE9SOFTWAREVAL K:621 , ALA K:622 , GLY K:623 , TRP K:624 , MET K:662 , CYS K:663 , SER K:664 , PHE K:665 , ARG K:685 , PHE K:686 , ASN K:688 , HIS K:689 , TYR K:726binding site for residue SAH K 1009
28AF1SOFTWARECYS Q:286 , CYS Q:289 , CYS Q:294 , HIS Q:297binding site for residue ZN Q 1001
29AF2SOFTWARECYS Q:320 , GLN Q:323 , CYS Q:452 , CYS Q:463binding site for residue ZN Q 1002
30AF3SOFTWARECYS Q:530 , CYS Q:543 , CYS Q:549 , CYS Q:553binding site for residue ZN Q 1003
31AF4SOFTWARECYS Q:523 , HIS Q:525 , CYS Q:530 , CYS Q:534binding site for residue ZN Q 1004
32AF5SOFTWARECYS Q:523 , CYS Q:536 , CYS Q:543 , CYS Q:547binding site for residue ZN Q 1005
33AF6SOFTWARECYS Q:566 , CYS Q:580 , CYS Q:588 , CYS Q:601 , ZN Q:1008binding site for residue ZN Q 1006
34AF7SOFTWARECYS Q:560 , CYS Q:573 , CYS Q:580 , CYS Q:585 , ZN Q:1008binding site for residue ZN Q 1007
35AF8SOFTWARECYS Q:560 , CYS Q:562 , CYS Q:566 , CYS Q:571 , ZN Q:1006 , ZN Q:1007binding site for residue ZN Q 1008
36AF9SOFTWAREVAL Q:621 , ALA Q:622 , GLY Q:623 , TRP Q:624 , MET Q:662 , CYS Q:663 , SER Q:664 , PHE Q:665 , PHE Q:686 , ASN Q:688 , HIS Q:689 , TYR Q:726 , ALA Q:733 , LEU Q:734 , LYS Q:735binding site for residue SAH Q 1009
37AG1SOFTWAREASP F:136 , GLU F:137 , ASP F:140 , TYR G:148 , ILE G:363 , TRP G:364 , TYR G:365 , ARG G:414 , GLN J:5 , PHE J:8 , GLN J:10binding site for Di-peptide ARG J 6 and M3L J 7
38AG2SOFTWAREASP F:136 , GLU F:137 , TYR G:148 , ILE G:363 , TRP G:364 , TYR G:365 , ARG G:414 , ARG J:6 , ALA J:9binding site for Di-peptide M3L J 7 and PHE J 8
39AG3SOFTWARETYR K:133 , ASP K:136 , ASP K:140 , TYR L:148 , ILE L:363 , TRP L:364 , ARG L:414 , GLN P:3 , ALA P:4 , GLN P:5 , PHE P:8 , GLN P:10binding site for Di-peptide ARG P 6 and M3L P 7
40AG4SOFTWARETYR K:133 , ASP K:136 , GLU K:137 , TYR L:148 , ILE L:363 , TRP L:364 , ARG L:414 , ARG P:6 , ALA P:9 , GLN P:10binding site for Di-peptide M3L P 7 and PHE P 8
41AG5SOFTWARETYR Q:133 , ASP Q:136 , TYR R:148 , ILE R:363 , TRP R:364 , TYR R:365 , ARG R:414 , ALA U:4 , GLN U:5 , PHE U:8 , GLN U:10binding site for Di-peptide ARG U 6 and M3L U 7
42AG6SOFTWARETYR Q:133 , ASP Q:136 , PHE R:97 , TYR R:148 , ILE R:363 , TRP R:364 , TYR R:365 , ARG R:414 , ASP R:430 , ARG U:6 , ALA U:9binding site for Di-peptide M3L U 7 and PHE U 8

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5HYN)

(-) Cis Peptide Bonds  (85, 85)

Asymmetric Unit
No.Residues
1Ser A:73 -Val A:74
2Gln A:141 -Asp A:142
3His A:158 -Gly A:159
4Ser A:212 -Arg A:213
5Pro A:214 -Pro A:215
6Gly A:235 -Thr A:236
7Pro A:258 -Glu A:259
8Thr A:302 -Pro A:303
9Thr A:311 -Glu A:312
10Glu A:312 -Thr A:313
11Lys A:318 -Pro A:319
12Cys A:320 -Gly A:321
13Gly A:321 -Pro A:322
14Gln A:326 -His A:327
15Ser A:729 -Gln A:730
16Asp A:732 -Ala A:733
17Leu A:734 -Lys A:735
18Val A:737 -Gly A:738
19Lys B:79 -Tyr B:80
20Ser B:128 -Gln B:129
21Pro B:396 -His B:397
22His B:397 -Lys B:398
23Ala B:399 -Lys B:400
24His C:561 -Asn C:562
25Met C:579 -Glu C:580
26Val C:581 -Asp C:582
27Glu C:586 -Lys C:587
28Glu C:608 -Gly C:609
29Ser F:73 -Val F:74
30Glu F:137 -Val F:138
31Asp F:140 -Gln F:141
32His F:158 -Gly F:159
33Gly F:235 -Thr F:236
34Thr F:302 -Pro F:303
35Leu F:315 -Asp F:316
36Lys F:318 -Pro F:319
37Cys F:320 -Gly F:321
38Gln F:326 -His F:327
39Asp F:592 -His F:593
40Ser F:729 -Gln F:730
41Asp F:732 -Ala F:733
42Ala G:399 -Lys G:400
43Met H:579 -Glu H:580
44Glu H:580 -Val H:581
45Glu H:584 -Asp H:585
46Thr I:22 -Lys I:23
47Pro K:67 -Val K:68
48Thr K:72 -Ser K:73
49Phe K:91 -Pro K:92
50Asp K:140 -Gln K:141
51His K:158 -Gly K:159
52Thr K:302 -Pro K:303
53Ala K:314 -Leu K:315
54Pro K:319 -Cys K:320
55Gly K:321 -Pro K:322
56Gln K:326 -His K:327
57Asp K:592 -His K:593
58Ser K:729 -Gln K:730
59Lys L:79 -Tyr L:80
60Glu L:392 -Val L:393
61Asp L:395 -Pro L:396
62Ala L:399 -Lys L:400
63Asp M:585 -Glu M:586
64Glu M:586 -Lys M:587
65Leu Q:71 -Thr Q:72
66Val Q:74 -Ser Q:75
67Met Q:134 -Gly Q:135
68Val Q:138 -Leu Q:139
69Leu Q:139 -Asp Q:140
70Asp Q:140 -Gln Q:141
71Cys Q:163 -Gly Q:164
72Cys Q:260 -Thr Q:261
73Ile Q:264 -Asp Q:265
74Thr Q:302 -Pro Q:303
75Lys Q:318 -Pro Q:319
76Cys Q:320 -Gly Q:321
77Gly Q:321 -Pro Q:322
78Ser Q:729 -Gln Q:730
79Asp Q:732 -Ala Q:733
80Glu R:392 -Val R:393
81Asp R:395 -Pro R:396
82Ala R:399 -Lys R:400
83His S:561 -Asn S:562
84Val S:581 -Asp S:582
85Lys S:587 -Asp S:588

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5HYN)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5HYN)

(-) Exons   (0, 0)

(no "Exon" information available for 5HYN)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:581
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..................eeeeee......eeee.eee............ee....ee............hhhhhh...hhhhhhhhhhh.............hhhhhhhhhhhhhhhh.......hhhhhhhhhhh....hhhhhhhhhhhhhh................hhhhhhhhhhhhh.............................................hhhhhhhhhhhhhh............hhhhhhhhhhhhhhhh.hhhhhhhhhh..hhhhhhhhhhhhhh......................hhhhhh...............................hhhhhh.....................................eeeee.....eeeee........eeee..eeeeehhhhhhhhhhhhhh....eee....eeeeeeeee.hhhhhee.....eeeeeeee..eeeeeeee..........ee................ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hyn A  10 KGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNESRPPRSDKIFEAISSMFPDKGTAEELKEKYKELTEPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIE 740
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179  ||   220       230       240       257       267       277       287       297       307       317       327       337       423       433       443       453       463       473     ||519       529       539       549       559       569       579       589       599       609       619       629       639       649       659       669       679       689       699       709       719       729       739 
                                                                                                                                                                                                      182|  216|                          249|                                                                                     345|                                                      479|                                                                                                                                                                                                                                
                                                                                                                                                                                                       211   220                           257                                                                                      422                                                       516                                                                                                                                                                                                                                


Chain B from PDB  Type:PROTEIN  Length:365
                                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeee.....eeeeee..........eeeeee..eeeeeeee...eeeeeeeeee......eeeeeeee......eeeeeee....eeeee....eeeeee......eeeeee......eeeeee....eeeee....eeeee..........eeeeee.....eeeeee....eeeee..hhhhhhhhhhhhhh...........ee.....eee.......eeeeeee..eeeeee...eeeeeee.....hhhhh......eeeeeeee..........eee.....eeeee.....eeeee...........eee........eeeeee.....eeeeee...eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hyn B  77 KCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR 441
                                    86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436     


Chain C from PDB  Type:PROTEIN  Length:125
                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............................hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh....hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hyn C 561 HNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQ 685
                                   570       580       590       600       610       620       630       640       650       660       670       680     


Chain D from PDB  Type:PROTEIN  Length:9
                                         
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ......... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 5hyn D  22 TKAARMSAP  30


Chain E from PDB  Type:PROTEIN  Length:11
                                           
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author ........... Sec.struct. author
                 SAPs(SNPs) ----------- SAPs(SNPs)
                    PROSITE ----------- PROSITE
                 Transcript ----------- Transcript
                 5hyn E   1 RLQAQRkFAQS  11
                                  | 10 
                                  7-M3L


Chain F from PDB  Type:PROTEIN  Length:568
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..................eeeeee......eeee.eee............ee....ee......................hhhhhhhhhh.............hhhhhhhhhhhhhhh...hhhhhhhhhh....hhhhhhhhhhhhh..............hhhhhhhhhhhhh.............................................hhhhhhhhhhhhh...........hhhhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhhhh.....................hhhhhh...............................hhhhhh...........................hhhhhh....eeeee.....eeeee........eeee..eeeeehhhhhhhhhhhhhhh...eee....eeeeeeeee.hhhhhee.....eeeeeeee..eeeeeeee..........ee............... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hyn F  10 KGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYPSDKIFEAISSMFPDKGTAEELKEKYKELTECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGI 739
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179 ||    226       236       246 ||    266       276       286       296       306       316       326       336       424       434       444       454       464       474   ||  521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731        
                                                                                                                                                                                                     181|                          248|                                                                                   345|                                                   478|                                                                                                                                                                                                                               
                                                                                                                                                                                                      219                           259                                                                                    424                                                    516                                                                                                                                                                                                                               


Chain G from PDB  Type:PROTEIN  Length:365
                                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeee.....eeeeee.........eeeeeee..eeeeeee.hhh.eeeeeeeee......eeeeeeee......eeeeeee....eeeee....eeeeee......eeeeee......eeeeee....eeeee....eeeeee.........eeeeee.....eeeeee....eeeee..hhhhhhhhhhhhhh...........eee....eee.......eeeeeee..eeeeee...eeeeeee.....hhhhh......eeeeeeee..........eee.....eeeee.....eeeee..........eeee........eeeeee.....eeeeee...eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hyn G  77 KCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR 441
                                    86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436     


Chain H from PDB  Type:PROTEIN  Length:124
                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhh.........hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh....hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hyn H 562 NRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQ 685
                                   571       581       591       601       611       621       631       641       651       661       671       681    


Chain I from PDB  Type:PROTEIN  Length:9
                                         
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ......... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 5hyn I  22 TKAARMSAP  30


Chain J from PDB  Type:PROTEIN  Length:10
                                          
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
               Pfam domains ---------- Pfam domains
         Sec.struct. author .......... Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
                 Transcript ---------- Transcript
                 5hyn J   2 LQAQRkFAQS  11
                                 |  11
                                 7-M3L


Chain K from PDB  Type:PROTEIN  Length:562
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..................eeeeee.....eeeee.eee............ee....ee......................hhhhhhhhhh.............hhhhhhhhhhhhhh..hhhhhhhhhhhh....hhhhhhhhhhhh.............hhhhhhhhhhhhh..............................................hhhhhhhhhhhhh...........hhhhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhhhhh......................hhhhhhh..............................hhhhhh...........................hhhhhh....eeeee.....eeeee........eeee..eeeeehhhhhhhhhhhhhhh...eee....eeeeeeeee.hhhhhee.....eeeeeeee..eeeeeeee..........ee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hyn K  10 KGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYPSDKIFEAISSMFPDKGTAEELKEKYKELCTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQAD 732
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179 ||    226       236       246||     268       278       288       298       308       318       328       338      |425       435       445       455       465       475   ||  520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730  
                                                                                                                                                                                                     181|                         247|                                                                                  345|                                                     479|                                                                                                                                                                                                                         
                                                                                                                                                                                                      219                          260                                                                                   423                                                      515                                                                                                                                                                                                                         


Chain L from PDB  Type:PROTEIN  Length:365
                                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeee.....eeeeee.........eeeeeee..eeeeeeee...eeeeeeeeee......eeeeeeeee....eeeeeeee....eeeee....eeeeee......eeeeee......eeeeee....eeeee....eeeeee.........eeeeee.....eeeeee....eeeee..hhhhhhhhhhhhhh...........eee....eee.......eeeeeee..eeeeee...eeeeeee.....hhhhh......eeeeeeee..........eee.....eeeee.....eeeee..........eeee........eeeeee.....eeeeee...eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hyn L  77 KCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR 441
                                    86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436     


Chain M from PDB  Type:PROTEIN  Length:125
                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............................hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hyn M 561 HNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQ 685
                                   570       580       590       600       610       620       630       640       650       660       670       680     


Chain O from PDB  Type:PROTEIN  Length:9
                                         
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ......... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 5hyn O  22 TKAARMSAP  30


Chain P from PDB  Type:PROTEIN  Length:9
                                         
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ......... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 5hyn P   3 QAQRkFAQS  11
                                |    
                                7-M3L


Chain Q from PDB  Type:PROTEIN  Length:565
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..................eeeeee......eeee.eee............ee....ee....................hhhhhhhhhhhh.............hhhhhhhhhhhhhh...hhhhhhhh.hhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhh.............................................hhhhhhhhhhhhhh..........hhhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhhhhh.....................hhhhhhh..............................hhhhhh...........................hhhhhh....eeeee.....eeeee........eeee..eeeeehhhhhhhhhhhhhhh...eee....eeeeeeeee.hhhhhee.....eeeeeeee..eeeeeeee..........ee............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hyn Q  12 PVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQPSDKIFEAISSMFPDKGTAEELKEKYKELTECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIANHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGI 739
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       219       229       239       259       269       279       289       299       309       319       329       339     ||428       438       448       458       468       478|      524       534       544       554       564       574       584       594       604       614       624       634       644       654       664       674       684       694       704       714       724       734     
                                                                                                                                                                                                  180|                          248|                                                                                   345|                                                  478|                                                                                                                                                                                                                                
                                                                                                                                                                                                   219                           259                                                                                    425                                                   515                                                                                                                                                                                                                                


Chain R from PDB  Type:PROTEIN  Length:365
                                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeeeee.....eeeeee.........eeeeeee..eeeeeee.hhh.eeeeeeeee......eeeeeeee......eeeeeee....eeeee....eeeeee......eeeeee......eeeeee....eeeee....eeeeee.........eeeeee.....eeeeee....eeeee..hhhhhhhhhhhhhh...........eee....eee.........eeeee..eeeee....eeeeeee.....hhhhh......eeeeeeee..........eee.....eeeee.....eeeee...........eee........eeeeee.....eeeeee...eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hyn R  77 KCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR 441
                                    86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436     


Chain S from PDB  Type:PROTEIN  Length:125
                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhh.........hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hyn S 561 HNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQ 685
                                   570       580       590       600       610       620       630       640       650       660       670       680     


Chain T from PDB  Type:PROTEIN  Length:9
                                         
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author ......... Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 5hyn T  22 TKAARMSAP  30


Chain U from PDB  Type:PROTEIN  Length:10
                                          
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
               Pfam domains ---------- Pfam domains
         Sec.struct. author .......... Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
                 Transcript ---------- Transcript
                 5hyn U   2 LQAQRkFAQS  11
                                 |  11
                                 7-M3L
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5HYN)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5HYN)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5HYN)

(-) Gene Ontology  (109, 155)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    M3L  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SAH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
    AG6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala B:399 - Lys B:400   [ RasMol ]  
    Ala G:399 - Lys G:400   [ RasMol ]  
    Ala K:314 - Leu K:315   [ RasMol ]  
    Ala L:399 - Lys L:400   [ RasMol ]  
    Ala R:399 - Lys R:400   [ RasMol ]  
    Asp A:732 - Ala A:733   [ RasMol ]  
    Asp F:140 - Gln F:141   [ RasMol ]  
    Asp F:592 - His F:593   [ RasMol ]  
    Asp F:732 - Ala F:733   [ RasMol ]  
    Asp K:140 - Gln K:141   [ RasMol ]  
    Asp K:592 - His K:593   [ RasMol ]  
    Asp L:395 - Pro L:396   [ RasMol ]  
    Asp M:585 - Glu M:586   [ RasMol ]  
    Asp Q:140 - Gln Q:141   [ RasMol ]  
    Asp Q:732 - Ala Q:733   [ RasMol ]  
    Asp R:395 - Pro R:396   [ RasMol ]  
    Cys A:320 - Gly A:321   [ RasMol ]  
    Cys F:320 - Gly F:321   [ RasMol ]  
    Cys Q:163 - Gly Q:164   [ RasMol ]  
    Cys Q:260 - Thr Q:261   [ RasMol ]  
    Cys Q:320 - Gly Q:321   [ RasMol ]  
    Gln A:141 - Asp A:142   [ RasMol ]  
    Gln A:326 - His A:327   [ RasMol ]  
    Gln F:326 - His F:327   [ RasMol ]  
    Gln K:326 - His K:327   [ RasMol ]  
    Glu A:312 - Thr A:313   [ RasMol ]  
    Glu C:586 - Lys C:587   [ RasMol ]  
    Glu C:608 - Gly C:609   [ RasMol ]  
    Glu F:137 - Val F:138   [ RasMol ]  
    Glu H:580 - Val H:581   [ RasMol ]  
    Glu H:584 - Asp H:585   [ RasMol ]  
    Glu L:392 - Val L:393   [ RasMol ]  
    Glu M:586 - Lys M:587   [ RasMol ]  
    Glu R:392 - Val R:393   [ RasMol ]  
    Gly A:235 - Thr A:236   [ RasMol ]  
    Gly A:321 - Pro A:322   [ RasMol ]  
    Gly F:235 - Thr F:236   [ RasMol ]  
    Gly K:321 - Pro K:322   [ RasMol ]  
    Gly Q:321 - Pro Q:322   [ RasMol ]  
    His A:158 - Gly A:159   [ RasMol ]  
    His B:397 - Lys B:398   [ RasMol ]  
    His C:561 - Asn C:562   [ RasMol ]  
    His F:158 - Gly F:159   [ RasMol ]  
    His K:158 - Gly K:159   [ RasMol ]  
    His S:561 - Asn S:562   [ RasMol ]  
    Ile Q:264 - Asp Q:265   [ RasMol ]  
    Leu A:734 - Lys A:735   [ RasMol ]  
    Leu F:315 - Asp F:316   [ RasMol ]  
    Leu Q:139 - Asp Q:140   [ RasMol ]  
    Leu Q:71 - Thr Q:72   [ RasMol ]  
    Lys A:318 - Pro A:319   [ RasMol ]  
    Lys B:79 - Tyr B:80   [ RasMol ]  
    Lys F:318 - Pro F:319   [ RasMol ]  
    Lys L:79 - Tyr L:80   [ RasMol ]  
    Lys Q:318 - Pro Q:319   [ RasMol ]  
    Lys S:587 - Asp S:588   [ RasMol ]  
    Met C:579 - Glu C:580   [ RasMol ]  
    Met H:579 - Glu H:580   [ RasMol ]  
    Met Q:134 - Gly Q:135   [ RasMol ]  
    Phe K:91 - Pro K:92   [ RasMol ]  
    Pro A:214 - Pro A:215   [ RasMol ]  
    Pro A:258 - Glu A:259   [ RasMol ]  
    Pro B:396 - His B:397   [ RasMol ]  
    Pro K:319 - Cys K:320   [ RasMol ]  
    Pro K:67 - Val K:68   [ RasMol ]  
    Ser A:212 - Arg A:213   [ RasMol ]  
    Ser A:729 - Gln A:730   [ RasMol ]  
    Ser A:73 - Val A:74   [ RasMol ]  
    Ser B:128 - Gln B:129   [ RasMol ]  
    Ser F:729 - Gln F:730   [ RasMol ]  
    Ser F:73 - Val F:74   [ RasMol ]  
    Ser K:729 - Gln K:730   [ RasMol ]  
    Ser Q:729 - Gln Q:730   [ RasMol ]  
    Thr A:302 - Pro A:303   [ RasMol ]  
    Thr A:311 - Glu A:312   [ RasMol ]  
    Thr F:302 - Pro F:303   [ RasMol ]  
    Thr I:22 - Lys I:23   [ RasMol ]  
    Thr K:302 - Pro K:303   [ RasMol ]  
    Thr K:72 - Ser K:73   [ RasMol ]  
    Thr Q:302 - Pro Q:303   [ RasMol ]  
    Val A:737 - Gly A:738   [ RasMol ]  
    Val C:581 - Asp C:582   [ RasMol ]  
    Val Q:138 - Leu Q:139   [ RasMol ]  
    Val Q:74 - Ser Q:75   [ RasMol ]  
    Val S:581 - Asp S:582   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format | Biol. Unit 5 PNG format | Biol. Unit 6 PNG format | Biol. Unit 7 PNG format | Biol. Unit 8 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5hyn
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  EED_HUMAN | O75530
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  EZH2_HUMAN | Q15910
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  H31_HUMAN | P68431
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  JARD2_HUMAN | Q92833
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  SUZ12_HUMAN | Q15022
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.43
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  EED_HUMAN | O75530
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  EZH2_HUMAN | Q15910
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  H31_HUMAN | P68431
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  JARD2_HUMAN | Q92833
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SUZ12_HUMAN | Q15022
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        EED_HUMAN | O75530: 3iiw 3iiy 3ij0 3ij1 3ijc 3jpx 3jzg 3jzh 3jzn 3k26 3k27 4x3e 5gsa 5h13 5h14 5h15 5h17 5h19 5h24 5h25 5ij7 5ij8 5k0m 5ls6 5ttw 5u5h 5u5k 5u5t 5u62 5u69 5u6d 5u8a 5u8f 5wuk
        EZH2_HUMAN | Q15910: 2c6v 4mi0 4mi5 5gsa 5h14 5h15 5h17 5h19 5h24 5h25 5ij7 5ij8 5ls6 5u5t 5u62 5wuk
        H31_HUMAN | P68431: 1cs9 1ct6 1guw 1o9s 1q3l 2b2t 2b2u 2b2v 2b2w 2c1j 2c1n 2cv5 2kwj 2kwk 2l75 2lbm 2m0o 2ndf 2ndg 2oq6 2ot7 2ox0 2ri7 2uxn 2v89 2vpg 2x0l 3a1b 3afa 3avr 3ayw 3aze 3azf 3azg 3azh 3azi 3azj 3azk 3azl 3azm 3azn 3b95 3kmt 3kqi 3lqi 3lqj 3o34 3o35 3o37 3qj6 3rig 3riy 3sou 3sow 3u31 3u3d 3u4s 3u5n 3u5o 3u5p 3uee 3uef 3uig 3uii 3uik 3v43 3w96 3w97 3w98 3w99 3wa9 3waa 3wkj 3x1s 3x1t 3x1u 3x1v 3zg6 3zvy 4a0j 4a0n 4a7j 4bd3 4c1q 4f4u 4f56 4ft2 4ft4 4fwf 4hon 4i51 4l7x 4lk9 4lka 4llb 4lxl 4n4h 4qbq 4qbr 4qbs 4tn7 4u68 4up0 4uy4 4x3k 4y6l 4yhp 4yhz 4ym5 4ym6 4z0r 4z2m 5av5 5av6 5av8 5av9 5avb 5avc 5b24 5b2i 5b2j 5b31 5c11 5c13 5c3i 5cpi 5cpj 5cpk 5d6y 5dah 5fb0 5fb1 5ffv 5gse 5gsu 5gt0 5gt3 5gtc 5hjb 5hjc 5hjd 5iql 5j3v 5j9s 5jhn 5jin 5jiy 5jj0 5jrg 5kjh 5kji 5kkl 5m5g 5svx 5svy 5t0k 5t0m 5t1g 5t1i 5t8r 5tbn 5tdr 5tdw 5v21 5v22 5va6
        JARD2_HUMAN | Q92833: 5ls6
        SUZ12_HUMAN | Q15022: 5ij7 5ij8 5ls6

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5HYN)