4D0N - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   AKAP13 (AKAP-LBC) RHOGEF DOMAIN IN COMPLEX WITH RHOA

Authors :   K. R. Abdul Azeez, L. Shrestha, T. Krojer, C. Allerston, F. Von Delft, C. Bountra, C. Arrowsmith, A. M. Edwards, S. Knapp, E. Klussmann, J. M.

Date :   29 Apr 14 (Deposition) - 21 May 14 (Release) - 26 Nov 14 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym./Biol. Unit : A,B

Keywords :   Cell Cycle, Akap13, Lbc, Akap-Lbc, Gef, Rhogef, Dh Domain, Ph Domain (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. R. Abdul Azeez, S. Knapp, J. M. P. Fernandes, E. Klussmann, J. M. Elkins
The Crystal Structure Of The Rhoa : Akap-Lbc Dh-Ph Domain Complex.
Biochem. J. V. 464 231 2014
PubMed-ID: 25186459 | Reference-DOI: 10.1042/BJ20140606

Molecule 1 - TRANSFORMING PROTEIN RHOA
	Chains	:	A
	EC Number	:	3.6.5.2
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PNIC28-BSA4
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 1-184
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	RHOA, RHO CDNA CLONE 12, H12

Molecule 2 - A-KINASE ANCHOR PROTEIN 13
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Fragment	:	RHOGEF DOMAIN, RESIDUES 1968-2338
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	AKAP13, AKAP-13, AKAP-LBC, BREAST CANCER NUCLEAR RECEPTOR-BINDING AUXILIARY PROTEIN, GUANINE NUCLEOTIDE EXCHANGE FACTOR LBC, HUMAN THYROID-ANCHORING PROTEIN 31, LYMPHOID BLAST CRISIS ONCOGENE, LBC ONCOGENE, NON-ONCOGENIC RHO GTPASE-SPECIFIC GTP EXCHANGE FACTOR, PROTEIN KINASE A-ANCHORING PROTEIN 13, PRKA13, P47

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 7)

No.	Name	Count	Type	Full Name
1	EDO	1	Ligand/Ion	1,2-ETHANEDIOL
2	GDP	1	Ligand/Ion	GUANOSINE-5'-DIPHOSPHATE
3	SO4	5	Ligand/Ion	SULFATE ION

Asymmetric Unit (7, 7)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ALA A:15 , CYS A:16 , GLY A:17 , LYS A:18 , THR A:19 , CYS A:20 , ALA A:61 , LYS A:118 , ASP A:120 , LEU A:121 , SER A:160 , ALA A:161 , LYS A:162 , HOH A:2007 , HOH A:2030 , HOH A:2074 , SO4 B:3342	BINDING SITE FOR RESIDUE GDP A1182
2	AC2	SOFTWARE	GLN B:2055 , ARG B:2059 , ASN B:2087 , ASN B:2093	BINDING SITE FOR RESIDUE SO4 B3341
3	AC3	SOFTWARE	GDP A:1182 , LYS B:1998 , ARG B:2163 , GLN B:2166	BINDING SITE FOR RESIDUE SO4 B3342
4	AC4	SOFTWARE	LYS B:1993 , LYS B:1994	BINDING SITE FOR RESIDUE SO4 B3343
5	AC5	SOFTWARE	ARG A:68 , SER B:2194	BINDING SITE FOR RESIDUE SO4 A1183
6	AC6	SOFTWARE	VAL B:2138 , ARG B:2139 , ARG B:2140	BINDING SITE FOR RESIDUE SO4 B3344
7	AC7	SOFTWARE	LYS A:7 , LEU A:72 , PRO A:75 , HOH A:2038 , HOH A:2076 , HOH A:3577 , HIS B:2108	BINDING SITE FOR RESIDUE EDO A1184

(no "SS Bond" information available for 4D0N)

Asymmetric/Biological Unit

No.	Residues
1	Ala A:3	-	Ile A:4
2	Lys B:2232	-	Arg B:2233

(no "SAP(SNP)/Variant" information available for 4D0N)

Asymmetric/Biological Unit (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	DH_2	PS50010	Dbl homology (DH) domain profile.	AKP13_HUMAN	1994-2191	1	B:1998-2195
2	PH_DOMAIN	PS50003	PH domain profile.	AKP13_HUMAN	2231-2333	1	B:2235-2337

Asymmetric/Biological Unit (8, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000394518	1	ENSE00001302181	chr15:85923871-85924029	159	AKP13_HUMAN	-	0	0	-	-
1.2	ENST00000394518	2	ENSE00001332196	chr15:86028941-86028984	44	AKP13_HUMAN	1-11	11	0	-	-
1.4	ENST00000394518	4	ENSE00001332207	chr15:86064659-86064806	148	AKP13_HUMAN	12-61	50	0	-	-
1.5a	ENST00000394518	5a	ENSE00001106086	chr15:86076815-86077111	297	AKP13_HUMAN	61-160	100	0	-	-
1.6	ENST00000394518	6	ENSE00001255215	chr15:86087003-86087186	184	AKP13_HUMAN	160-221	62	0	-	-
1.7	ENST00000394518	7	ENSE00001255210	chr15:86118362-86118560	199	AKP13_HUMAN	221-287	67	0	-	-
1.8	ENST00000394518	8	ENSE00000924595	chr15:86122161-86125338	3178	AKP13_HUMAN	288-1347	1060	0	-	-
1.9	ENST00000394518	9	ENSE00000924596	chr15:86128933-86129054	122	AKP13_HUMAN	1347-1387	41	0	-	-
1.12	ENST00000394518	12	ENSE00001161572	chr15:86182605-86182680	76	AKP13_HUMAN	1388-1413	26	0	-	-
1.13	ENST00000394518	13	ENSE00001183573	chr15:86189049-86189185	137	AKP13_HUMAN	1413-1458	46	0	-	-
1.14	ENST00000394518	14	ENSE00001255357	chr15:86198648-86199018	371	AKP13_HUMAN	1459-1582	124	0	-	-
1.15	ENST00000394518	15	ENSE00001183389	chr15:86201768-86201821	54	AKP13_HUMAN	1582-1600	19	0	-	-
1.17	ENST00000394518	17	ENSE00001183388	chr15:86207794-86207986	193	AKP13_HUMAN	1600-1664	65	0	-	-
1.18	ENST00000394518	18	ENSE00000924601	chr15:86212953-86213061	109	AKP13_HUMAN	1665-1701	37	0	-	-
1.20	ENST00000394518	20	ENSE00001639921	chr15:86225389-86225443	55	AKP13_HUMAN	1701-1719	19	0	-	-
1.21	ENST00000394518	21	ENSE00002188320	chr15:86227972-86228104	133	AKP13_HUMAN	1719-1763	45	0	-	-
1.22	ENST00000394518	22	ENSE00001652051	chr15:86236508-86236682	175	AKP13_HUMAN	1764-1822	59	0	-	-
1.23	ENST00000394518	23	ENSE00001711074	chr15:86251250-86251317	68	AKP13_HUMAN	1822-1844	23	0	-	-
1.24	ENST00000394518	24	ENSE00001771305	chr15:86253810-86253876	67	AKP13_HUMAN	1845-1867	23	0	-	-
1.25	ENST00000394518	25	ENSE00001719928	chr15:86259019-86259154	136	AKP13_HUMAN	1867-1912	46	0	-	-
1.26	ENST00000394518	26	ENSE00001689611	chr15:86260521-86260633	113	AKP13_HUMAN	1912-1950	39	0	-	-
1.27a	ENST00000394518	27a	ENSE00001798925	chr15:86261238-86261390	153	AKP13_HUMAN	1950-2001	52	1	B:1970-2005	36
1.28	ENST00000394518	28	ENSE00001697029	chr15:86262307-86262557	251	AKP13_HUMAN	2001-2084	84	1	B:2005-2088	84
1.29	ENST00000394518	29	ENSE00001649682	chr15:86265222-86265347	126	AKP13_HUMAN	2085-2126	42	1	B:2089-2130	42
1.30	ENST00000394518	30	ENSE00001612910	chr15:86265461-86265578	118	AKP13_HUMAN	2127-2166	40	1	B:2131-2170	40
1.31	ENST00000394518	31	ENSE00001803184	chr15:86266303-86266551	249	AKP13_HUMAN	2166-2249	84	1	B:2170-2253	84
1.32	ENST00000394518	32	ENSE00001753596	chr15:86269641-86269717	77	AKP13_HUMAN	2249-2274	26	1	B:2253-2278	26
1.33	ENST00000394518	33	ENSE00001735665	chr15:86270297-86270478	182	AKP13_HUMAN	2275-2335	61	1	B:2279-2339	61
1.34	ENST00000394518	34	ENSE00001678821	chr15:86270612-86270694	83	AKP13_HUMAN	2335-2363	29	1	B:2339-2340	2
1.35	ENST00000394518	35	ENSE00001629448	chr15:86273744-86273938	195	AKP13_HUMAN	2363-2428	66	0	-	-
1.36	ENST00000394518	36	ENSE00001734761	chr15:86278223-86278381	159	AKP13_HUMAN	2428-2481	54	0	-	-
1.37	ENST00000394518	37	ENSE00001762863	chr15:86278791-86278861	71	AKP13_HUMAN	2481-2504	24	0	-	-
1.38	ENST00000394518	38	ENSE00001747445	chr15:86279321-86279365	45	AKP13_HUMAN	2505-2519	15	0	-	-
1.39	ENST00000394518	39	ENSE00001637119	chr15:86283453-86283503	51	AKP13_HUMAN	2520-2536	17	0	-	-
1.40	ENST00000394518	40	ENSE00001776231	chr15:86284277-86284726	450	AKP13_HUMAN	2537-2686	150	0	-	-
1.41	ENST00000394518	41	ENSE00001594809	chr15:86286723-86287056	334	AKP13_HUMAN	2687-2798	112	0	-	-
1.42b	ENST00000394518	42b	ENSE00001390831	chr15:86287859-86292586	4728	AKP13_HUMAN	2798-2813	16	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:179
 aligned with RHOA_HUMAN | P61586 from UniProtKB/Swiss-Prot  Length:193

    Alignment length:179
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172         
          RHOA_HUMAN      3 AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA  181
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee....hhhhhhhhhhh..............eeeeeee..eeeeeeeee.........hhhhhh....eeeeeee..hhhhhhhhhhhhhhhhhhhh....eeeeeehhhhh.hhhhhhhhhh......hhhhhhhhhhhhh..eeee.......hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4d0n A    3 AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA  181
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172

Chain B from PDB  Type:PROTEIN  Length:371
 aligned with AKP13_HUMAN | Q12802 from UniProtKB/Swiss-Prot  Length:2813

    Alignment length:371
                                  1975      1985      1995      2005      2015      2025      2035      2045      2055      2065      2075      2085      2095      2105      2115      2125      2135      2145      2155      2165      2175      2185      2195      2205      2215      2225      2235      2245      2255      2265      2275      2285      2295      2305      2315      2325      2335 
         AKP13_HUMAN   1966 IESKQLEAESWSRIIDSKFLKQQKKDVVKRQEVIYELMQTEFHHVRTLKIMSGVYSQGMMADLLFEQQMVEKLFPCLDELISIHSQFFQRILERKKESLVDKSEKNFLIKRIGDVLVNQFSGENAERLKKTYGKFCGQHNQSVNYFKDLYAKDKRFQAFVKKKMSSSVVRRLGIPECILLVTQRITKYPVLFQRILQCTKDNEVEQEDLAQSLSLVKDVIGAVDSKVASYEKKVRLNEIYTKTDSKSIMRMKSGQMFAKEDLKRKKLVRDGSVFLKNAAGRLKEVQAVLLTDILVFLQEKDQKYIFASLDQKSTVISLKKLIVREVAHEEKGLFLISMGMTDPEMVEVHASSKEERNSWIQIIQDTINTLN 2336
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhh...hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eee.....eee.hhh....eeeeeeeeee.....eeeeeeeee..eeeeeeee..eeee........eee...eeeee......eeeeee.......eeeee..hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------DH_2  PDB: B:1998-2195 UniProt: 1994-2191                                                                                                                                                             ---------------------------------------PH_DOMAIN  PDB: B:2235-2337 UniProt: 2231-2333                                                         --- PROSITE
           Transcript 1 (1) Exon 1.27a  PDB: B:1970-2005        -----------------------------------------------------------------------------------Exon 1.29  PDB: B:2089-2130               Exon 1.30  PDB: B:2131-2170             ----------------------------------------------------------------------------------Exon 1.32  PDB: B:2253-227Exon 1.33  PDB: B:2279-2339 UniProt: 2275-2335               - Transcript 1 (1)
           Transcript 1 (2) -----------------------------------Exon 1.28  PDB: B:2005-2088 UniProt: 2001-2084                                      ---------------------------------------------------------------------------------Exon 1.31  PDB: B:2170-2253 UniProt: 2166-2249                                      -------------------------------------------------------------------------------------1. Transcript 1 (2)
                4d0n B 1970 SMSKQLEAESWSRIIDSKFLKQQKKDVVKRQEVIYELMQTEFHHVRTLKIMSGVYSQGMMADLLFEQQMVEKLFPCLDELISIHSQFFQRILERKKESLVDKSEKNFLIKRIGDVLVNQFSGENAERLKKTYGKFCGQHNQSVNYFKDLYAKDKRFQAFVKKKMSSSVVRRLGIPECILLVTQRITKYPVLFQRILQCTKDNEVEQEDLAQSLSLVKDVIGAVDSKVASYEKKVRLNEIYTKTDSKSIMRMKSGQMFAKEDLKRKKLVRDGSVFLKNAAGRLKEVQAVLLTDILVFLQEKDQKYIFASLDQKSTVISLKKLIVREVAHEEKGLFLISMGMTDPEMVEVHASSKEERNSWIQIIQDTINTLN 2340
                                  1979      1989      1999      2009      2019      2029      2039      2049      2059      2069      2079      2089      2099      2109      2119      2129      2139      2149      2159      2169      2179      2189      2199      2209      2219      2229      2239      2249      2259      2269      2279      2289      2299      2309      2319      2329      2339

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 4D0N)

(no "CATH Domain" information available for 4D0N)

(no "Pfam Domain" information available for 4D0N)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (RHOA_HUMAN | P61586)

molecular function
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0017022	myosin binding	Interacting selectively and non-covalently with any part of a myosin complex; myosins are any of a superfamily of molecular motor proteins that bind to actin and use the energy of ATP hydrolysis to generate force and movement along actin filaments.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007266	Rho protein signal transduction	A series of molecular signals within the cell that are mediated by a member of the Rho family of proteins switching to a GTP-bound active state.
	GO:0035385	Roundabout signaling pathway	A series of molecular signals initiated by the binding of a SLIT protein to a Roundabout (ROBO) family receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0060071	Wnt signaling pathway, planar cell polarity pathway	The series of molecular signals initiated by binding of a Wnt protein to a receptor on the surface of the target cell where activated receptors signal via downstream effectors including C-Jun N-terminal kinase (JNK) to modulate cytoskeletal elements and control cell polarity.
	GO:0030036	actin cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0031532	actin cytoskeleton reorganization	A process that is carried out at the cellular level which results in dynamic structural changes to the arrangement of constituent parts of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0043297	apical junction assembly	The formation of an apical junction, a functional unit located near the cell apex at the points of contact between epithelial cells composed of the tight junction, the zonula adherens junction and the desmosomes, by the aggregation, arrangement and bonding together of its constituents.
	GO:0038027	apolipoprotein A-I-mediated signaling pathway	A series of molecular signals initiated by the binding of apolipoprotein A-I to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0016477	cell migration	The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
	GO:0036089	cleavage furrow formation	Generation of the cleavage furrow, a shallow groove in the cell surface near the old metaphase plate that marks the site of cytokinesis. This process includes the recruitment and localized activation of signals such as RhoA at the site of the future furrow to ensure that furrowing initiates at the correct site in the cell.
	GO:0043542	endothelial cell migration	The orderly movement of an endothelial cell into the extracellular matrix to form an endothelium.
	GO:0097498	endothelial tube lumen extension	Any endothelial tube morphogenesis process by which the tube is increased in length.
	GO:0048013	ephrin receptor signaling pathway	The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
	GO:1903673	mitotic cleavage furrow formation	Any cleavage furrow formation that is involved in mitotic cell cycle.
	GO:0090307	mitotic spindle assembly	The aggregation, arrangement and bonding together of a set of components to form the spindle that contributes to the process of mitosis.
	GO:0050919	negative chemotaxis	The directed movement of a motile cell or organism towards a lower concentration of a chemical.
	GO:0050771	negative regulation of axonogenesis	Any process that stops, prevents, or reduces the frequency, rate or extent of axonogenesis.
	GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis	Any process that decreases the frequency, rate or extent of cell migration involved in sprouting angiogenesis. Cell migration involved in sprouting angiogenesis is the orderly movement of endothelial cells into the extracellular matrix in order to form new blood vessels contributing to the process of sprouting angiogenesis.
	GO:0043931	ossification involved in bone maturation	The formation of bone or of a bony substance, or the conversion of fibrous tissue or of cartilage into bone, involved in the progression of the skeleton from its formation to its mature state.
	GO:0048015	phosphatidylinositol-mediated signaling	A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
	GO:0030168	platelet activation	A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
	GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
	GO:0042346	positive regulation of NF-kappaB import into nucleus	Any process that activates or increases the frequency, rate or extent of transfer of NF-kappaB, a transcription factor for eukaryotic RNA polymerase II promoters, from the cytoplasm into the nucleus, across the nuclear membrane.
	GO:0050772	positive regulation of axonogenesis	Any process that activates or increases the frequency, rate or extent of axonogenesis.
	GO:0032467	positive regulation of cytokinesis	Any process that activates or increases the frequency, rate or extent of the division of the cytoplasm of a cell, and its separation into two daughter cells.
	GO:0060193	positive regulation of lipase activity	Any process that increases the frequency, rate or extent of lipase activity, the hydrolysis of a lipid or phospholipid.
	GO:0045666	positive regulation of neuron differentiation	Any process that activates or increases the frequency, rate or extent of neuron differentiation.
	GO:0071902	positive regulation of protein serine/threonine kinase activity	Any process that increases the rate, frequency, or extent of protein serine/threonine kinase activity.
	GO:0051496	positive regulation of stress fiber assembly	Any process that activates or increases the frequency, rate or extent of the assembly of a stress fiber, a bundle of microfilaments and other proteins found in fibroblasts.
	GO:0032956	regulation of actin cytoskeleton organization	Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0030334	regulation of cell migration	Any process that modulates the frequency, rate or extent of cell migration.
	GO:2000145	regulation of cell motility	Any process that modulates the frequency, rate or extent of cell motility.
	GO:0033688	regulation of osteoblast proliferation	Any process that modulates the frequency, rate or extent of osteoblast proliferation.
	GO:0051056	regulation of small GTPase mediated signal transduction	Any process that modulates the frequency, rate or extent of small GTPase mediated signal transduction.
	GO:1902766	skeletal muscle satellite cell migration	The orderly movement of a skeletal muscle satellite cell from one site to another. Migration of these cells is a key step in the process of growth and repair of skeletal muscle cells.
	GO:0007264	small GTPase mediated signal transduction	Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
	GO:0043149	stress fiber assembly	The aggregation, arrangement and bonding together of a set of components to form a stress fiber. A stress fiber is a contractile actin filament bundle that consists of short actin filaments with alternating polarity.
	GO:0021762	substantia nigra development	The progression of the substantia nigra over time from its initial formation until its mature state. The substantia nigra is the layer of gray substance that separates the posterior parts of the cerebral peduncles (tegmentum mesencephali) from the anterior parts; it normally includes a posterior compact part with many pigmented cells (pars compacta) and an anterior reticular part whose cells contain little pigment (pars reticularis).
	GO:0061383	trabecula morphogenesis	The process of shaping a trabecula in an organ. A trabecula is a small, often microscopic, tissue element in the form of a small beam, strut or rod, which generally has a mechanical function. Trabecula are usually but not necessarily, composed of dense collagenous tissue.
	GO:0007179	transforming growth factor beta receptor signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0048010	vascular endothelial growth factor receptor signaling pathway	Any series of molecular signals initiated by the binding of an extracellular ligand to a vascular endothelial growth factor receptor (VEGFR) located on the surface of the receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
	GO:0044319	wound healing, spreading of cells	The migration of a cell along or through a wound gap that contributes to the reestablishment of a continuous surface.
cellular component
	GO:0043296	apical junction complex	A functional unit located near the cell apex at the points of contact between epithelial cells, which in vertebrates is composed of the tight junction, the zonula adherens, and desmosomes and in some invertebrates, such as Drosophila, is composed of the subapical complex (SAC), the zonula adherens and the septate junction. Functions in the regulation of cell polarity, tissue integrity and intercellular adhesion and permeability.
	GO:0005938	cell cortex	The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0071944	cell periphery	The part of a cell encompassing the cell cortex, the plasma membrane, and any external encapsulating structures.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0032154	cleavage furrow	The cleavage furrow is a plasma membrane invagination at the cell division site. The cleavage furrow begins as a shallow groove and eventually deepens to divide the cytoplasm.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its cytoplasmic surface, but not integrated into the hydrophobic region.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0030027	lamellipodium	A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0030496	midbody	A thin cytoplasmic bridge formed between daughter cells at the end of cytokinesis. The midbody forms where the contractile ring constricts, and may persist for some time before finally breaking to complete cytokinesis.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0031982	vesicle	Any small, fluid-filled, spherical organelle enclosed by membrane.

Chain B (AKP13_HUMAN | Q12802)

molecular function
	GO:0005078	MAP-kinase scaffold activity	The binding activity of a molecule that functions as a physical support for the assembly of a multiprotein mitogen-activated protein kinase (MAPK) complex. Binds multiple kinases of the MAPKKK cascade, and also upstream signaling proteins, permitting those molecules to function in a coordinated way. Bringing together multiple enzymes and their substrates enables the signal to be transduced quickly and efficiently.
	GO:0017048	Rho GTPase binding	Interacting selectively and non-covalently with Rho protein, any member of the Rho subfamily of the Ras superfamily of monomeric GTPases. Proteins in the Rho subfamily are involved in relaying signals from cell-surface receptors to the actin cytoskeleton.
	GO:0005089	Rho guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Rho family. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0004691	cAMP-dependent protein kinase activity	Catalysis of the reaction: ATP + a protein = ADP + a phosphoprotein. This reaction requires the presence of cAMP.
	GO:0005085	guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032947	protein complex scaffold activity	A structural molecule activity that provides a physical support for the assembly of a multiprotein complex. The scaffold may or may not be part of the final complex.
	GO:0051018	protein kinase A binding	Interacting selectively and non-covalently with any subunit of protein kinase A.
	GO:0004871	signal transducer activity	Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
biological process
	GO:0007186	G-protein coupled receptor signaling pathway	A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
	GO:0071875	adrenergic receptor signaling pathway	A series of molecular signals generated as a consequence of an adrenergic receptor binding to one of its physiological ligands.
	GO:0086023	adrenergic receptor signaling pathway involved in heart process	A series of molecular signals beginning with a G-protein coupled adrenergic cell surface receptor combining with epinephrine or norepinephrine, which contributes to a circulatory system process carried out by the heart.
	GO:0060348	bone development	The process whose specific outcome is the progression of bone over time, from its formation to the mature structure. Bone is the hard skeletal connective tissue consisting of both mineral and cellular components.
	GO:0055007	cardiac muscle cell differentiation	The process in which a cardiac muscle precursor cell acquires specialized features of a cardiac muscle cell. Cardiac muscle cells are striated muscle cells that are responsible for heart contraction.
	GO:0007507	heart development	The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0035556	intracellular signal transduction	The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
	GO:0051168	nuclear export	The directed movement of substances out of the nucleus.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
	GO:0035025	positive regulation of Rho protein signal transduction	Any process that activates or increases the frequency, rate or extent of Rho protein signal transduction.
	GO:0043065	positive regulation of apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:0035023	regulation of Rho protein signal transduction	Any process that modulates the frequency, rate or extent of Rho protein signal transduction.
	GO:0010611	regulation of cardiac muscle hypertrophy	Any process that modulates the rate, frequency or extent of the enlargement or overgrowth of all or part of the heart due to an increase in size (not length) of individual cardiac muscle fibers, without cell division.
	GO:1900169	regulation of glucocorticoid mediated signaling pathway	Any process that modulates the frequency, rate or extent of glucocorticoid mediated signaling pathway.
	GO:0045859	regulation of protein kinase activity	Any process that modulates the frequency, rate or extent of protein kinase activity.
	GO:0060297	regulation of sarcomere organization	Any process that modulates the rate, frequency or extent myofibril assembly by organization of muscle actomyosin into sarcomeres. The sarcomere is the repeating unit of a myofibril in a muscle cell, composed of an array of overlapping thick and thin filaments between two adjacent Z discs.
	GO:0051056	regulation of small GTPase mediated signal transduction	Any process that modulates the frequency, rate or extent of small GTPase mediated signal transduction.
cellular component
	GO:0005938	cell cortex	The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
	GO:0030864	cortical actin cytoskeleton	The portion of the actin cytoskeleton, comprising filamentous actin and associated proteins, that lies just beneath the plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GDP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:3 - Ile A:4	[ RasMol ]
		Lys B:2232 - Arg B:2233	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	4d0n
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AKP13_HUMAN \| Q12802
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	RHOA_HUMAN \| P61586
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.6.5.2
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AKP13_HUMAN \| Q12802
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	RHOA_HUMAN \| P61586
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

4d0o	AKAP13 (AKAP-LBC) DH DOMAIN

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 7)

Sites (7, 7)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 2)

Exons (8, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (97, 104)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File