Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  BCL-XL IN COMPLEX WITH INHIBITOR (COMPOUND 10)
 
Authors :  P. E. Czabotar, G. Lessense, B. J. Smith, P. M. Colman
Date :  24 Jun 14  (Deposition) - 15 Oct 14  (Release) - 15 Oct 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,F  (1x)
Biol. Unit 4:  G,H  (1x)
Keywords :  Apoptosis, Drug Design (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. F. Koehler, P. Bergeron, E. F. Choo, K. Lau, C. Ndubaku, D. Dudley, P. Gibbons, B. E. Sleebs, C. S. Rye, G. Nikolakopoulos, C. Bui, S. Kulasegaram, W. J. Kersten, B. J. Smith, P. E. Czabotar, P. M. Colman D. C. Huang, J. B. Baell, K. G. Watson, L. Hasvold, Z. F. Tao, L. Wang, A. J. Souers, S. W. Elmore, J. A. Flygare, W. J. Fairbrother, G. Lessene
Structure-Guided Rescaffolding Of Selective Antagonists Of Bcl-Xl.
Acs Med. Chem. Lett. V. 5 662 2014
PubMed-ID: 24944740  |  Reference-DOI: 10.1021/ML500030P

(-) Compounds

Molecule 1 - BCL-2-LIKE PROTEIN 1
    Chains: A, B, C, D, E, F, G, H
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 1-26, 83-209
    Gene: BCL2L1, BCL2L, BCLX
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: BCL2-L-1,APOPTOSIS REGULATOR BCL-X

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit : ABCDEFGH
Biological Unit 1 (1x): AB      
Biological Unit 2 (1x):   CD    
Biological Unit 3 (1x):     EF  
Biological Unit 4 (1x):       GH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 23)

Asymmetric Unit (3, 23)
No.NameCountTypeFull Name
138H8Ligand/Ion2-[8-(1,3-BENZOTHIAZOL-2-YLCARBAMOYL)-3,4-DIHYDROISOQUINOLIN-2(1H)-YL]-5-{3-[4-(1H-PYRAZOLO[3,4-D]PYRIMIDIN-1-YL)PHENOXY]PROPYL}-1,3-THIAZOLE-4-CARBOXYLIC ACID
2ACT1Ligand/IonACETATE ION
3EDO14Ligand/Ion1,2-ETHANEDIOL
Biological Unit 1 (3, 10)
No.NameCountTypeFull Name
138H2Ligand/Ion2-[8-(1,3-BENZOTHIAZOL-2-YLCARBAMOYL)-3,4-DIHYDROISOQUINOLIN-2(1H)-YL]-5-{3-[4-(1H-PYRAZOLO[3,4-D]PYRIMIDIN-1-YL)PHENOXY]PROPYL}-1,3-THIAZOLE-4-CARBOXYLIC ACID
2ACT1Ligand/IonACETATE ION
3EDO7Ligand/Ion1,2-ETHANEDIOL
Biological Unit 2 (2, 5)
No.NameCountTypeFull Name
138H2Ligand/Ion2-[8-(1,3-BENZOTHIAZOL-2-YLCARBAMOYL)-3,4-DIHYDROISOQUINOLIN-2(1H)-YL]-5-{3-[4-(1H-PYRAZOLO[3,4-D]PYRIMIDIN-1-YL)PHENOXY]PROPYL}-1,3-THIAZOLE-4-CARBOXYLIC ACID
2ACT-1Ligand/IonACETATE ION
3EDO3Ligand/Ion1,2-ETHANEDIOL
Biological Unit 3 (2, 3)
No.NameCountTypeFull Name
138H2Ligand/Ion2-[8-(1,3-BENZOTHIAZOL-2-YLCARBAMOYL)-3,4-DIHYDROISOQUINOLIN-2(1H)-YL]-5-{3-[4-(1H-PYRAZOLO[3,4-D]PYRIMIDIN-1-YL)PHENOXY]PROPYL}-1,3-THIAZOLE-4-CARBOXYLIC ACID
2ACT-1Ligand/IonACETATE ION
3EDO1Ligand/Ion1,2-ETHANEDIOL
Biological Unit 4 (2, 5)
No.NameCountTypeFull Name
138H2Ligand/Ion2-[8-(1,3-BENZOTHIAZOL-2-YLCARBAMOYL)-3,4-DIHYDROISOQUINOLIN-2(1H)-YL]-5-{3-[4-(1H-PYRAZOLO[3,4-D]PYRIMIDIN-1-YL)PHENOXY]PROPYL}-1,3-THIAZOLE-4-CARBOXYLIC ACID
2ACT-1Ligand/IonACETATE ION
3EDO3Ligand/Ion1,2-ETHANEDIOL

(-) Sites  (23, 23)

Asymmetric Unit (23, 23)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREALA A:93 , GLU A:96 , PHE A:97 , TYR A:101 , ARG A:102 , PHE A:105 , SER A:106 , ASP A:107 , LEU A:108 , LEU A:130 , ASN A:136 , GLY A:138 , ARG A:139 , ALA A:142 , SER A:145 , PHE A:146 , ALA A:149 , TYR A:195 , HOH A:402 , HOH A:406 , HOH A:412 , HOH A:492binding site for residue 38H A 301
02AC2SOFTWAREGLU A:184 , ASN H:136 , TYR H:195 , 38H H:301binding site for residue EDO A 302
03AC3SOFTWAREGLN A:26 , ASP A:189 , HOH A:428 , HOH A:497binding site for residue EDO A 303
04AC4SOFTWAREGLN A:183 , GLU A:184 , ASN H:136binding site for residue EDO A 304
05AC5SOFTWARETRP A:181 , ASN A:185 , TYR H:195 , 38H H:301 , HOH H:419binding site for residue EDO A 305
06AC6SOFTWAREASN A:136 , TRP A:137 , TYR A:195binding site for residue EDO A 306
07AC7SOFTWAREVAL A:135 , TYR A:173 , HIS A:177 , HOH A:452 , HOH A:486binding site for residue EDO A 307
08AC8SOFTWARETRP A:24 , VAL B:163binding site for residue EDO A 308
09AC9SOFTWAREALA B:93 , GLU B:96 , PHE B:97 , TYR B:101 , ARG B:102 , PHE B:105 , SER B:106 , ASP B:107 , LEU B:108 , GLU B:129 , LEU B:130 , ASN B:136 , GLY B:138 , ARG B:139 , SER B:145 , PHE B:146 , ALA B:149 , LEU B:194 , TYR B:195 , HOH B:406binding site for residue 38H B 301
10AD1SOFTWAREALA A:167 , ARG B:6 , HOH B:431 , HOH B:438 , HOH F:434binding site for residue ACT B 302
11AD2SOFTWAREALA C:93 , GLU C:96 , PHE C:97 , TYR C:101 , ARG C:102 , PHE C:105 , SER C:106 , ASP C:107 , LEU C:108 , THR C:109 , LEU C:130 , ASN C:136 , GLY C:138 , ARG C:139 , SER C:145 , PHE C:146 , ALA C:149 , TYR C:195 , HOH C:401 , HOH C:404 , HOH C:468 , LYS H:157 , GLU H:158 , HOH H:401 , HOH H:405binding site for residue 38H C 301
12AD3SOFTWARESER C:14 , ALA C:84 , GLN C:88 , ARG C:91 , ASP D:11 , ARG D:91binding site for residue EDO C 302
13AD4SOFTWARESER C:0 , SER C:2 , TRP G:24binding site for residue EDO C 303
14AD5SOFTWAREGLN C:26 , MET C:83 , VAL C:86 , MET D:1binding site for residue EDO C 304
15AD6SOFTWAREALA D:93 , GLU D:96 , PHE D:97 , TYR D:101 , PHE D:105 , SER D:106 , ASP D:107 , LEU D:108 , LEU D:130 , ASN D:136 , GLY D:138 , ARG D:139 , ALA D:142 , SER D:145 , PHE D:146 , ALA D:149 , LEU D:194 , TYR D:195 , HOH D:403 , HOH D:435 , HOH D:462 , HOH D:485binding site for residue 38H D 301
16AD7SOFTWAREALA E:93 , GLU E:96 , PHE E:97 , TYR E:101 , ARG E:102 , PHE E:105 , SER E:106 , ASP E:107 , LEU E:108 , GLU E:129 , LEU E:130 , ASN E:136 , GLY E:138 , ARG E:139 , SER E:145 , PHE E:146 , ALA E:149 , LEU E:194 , TYR E:195 , HOH E:410 , HOH E:466 , HOH E:477 , HOH E:505 , ALA H:104binding site for residue 38H E 301
17AD8SOFTWAREALA F:93 , GLU F:96 , PHE F:97 , TYR F:101 , ARG F:102 , PHE F:105 , SER F:106 , ASP F:107 , LEU F:108 , LEU F:130 , ASN F:136 , GLY F:138 , ARG F:139 , SER F:145 , PHE F:146 , ALA F:149 , TYR F:195 , HOH F:482 , HOH F:500binding site for residue 38H F 301
18AD9SOFTWARESER E:164 , TRP F:24 , HOH F:435 , HOH F:438 , HOH F:452 , HOH F:490binding site for residue EDO F 302
19AE1SOFTWAREALA G:93 , GLU G:96 , PHE G:97 , TYR G:101 , ARG G:102 , PHE G:105 , SER G:106 , ASP G:107 , LEU G:108 , THR G:109 , GLU G:129 , LEU G:130 , ASN G:136 , GLY G:138 , ARG G:139 , SER G:145 , PHE G:146 , ALA G:149 , LEU G:194 , TYR G:195 , HOH G:404binding site for residue 38H G 301
20AE2SOFTWAREGLN C:3 , ARG G:6 , VAL G:10 , TRP G:24binding site for residue EDO G 302
21AE3SOFTWAREEDO A:302 , EDO A:305 , ALA H:93 , GLU H:96 , PHE H:97 , TYR H:101 , ARG H:102 , PHE H:105 , SER H:106 , ASP H:107 , LEU H:108 , GLU H:129 , LEU H:130 , ASN H:136 , GLY H:138 , ARG H:139 , SER H:145 , PHE H:146 , ALA H:149 , LEU H:194 , TYR H:195 , HOH H:451 , HOH H:452 , HOH H:469binding site for residue 38H H 301
22AE4SOFTWARETYR H:173 , HIS H:177binding site for residue EDO H 302
23AE5SOFTWAREHOH G:433 , SER H:25 , GLN H:26 , MET H:83 , HOH H:472binding site for residue EDO H 303

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4TUH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4TUH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4TUH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4TUH)

(-) Exons   (0, 0)

(no "Exon" information available for 4TUH)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:144
                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh.....hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4tuh A  -3 PLGSMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYG 196
                                     6        16        26|       92       102       112       122       132       142       152       162       172       182       192    
                                                        26|                                                                                                                 
                                                         83                                                                                                                 


Chain B from PDB  Type:PROTEIN  Length:145
                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh.....hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tuh B  -4 GPLGSMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYG 196
                                     5        15        25||      91       101       111       121       131       141       151       161       171       181       191     
                                                         26|                                                                                                                 
                                                          83                                                                                                                 


Chain C from PDB  Type:PROTEIN  Length:142
                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh.......hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tuh C   0 SMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGN 197
                                     9        19      ||85        95       105       115       125       135       145       155       165       175       185       195  
                                                     26|                                                                                                                  
                                                      83                                                                                                                  


Chain D from PDB  Type:PROTEIN  Length:141
                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh.....hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tuh D   1 MSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGN 197
                                    10        20     || 86        96       106       116       126       136       146       156       166       176       186       196 
                                                    26|                                                                                                                  
                                                     83                                                                                                                  


Chain E from PDB  Type:PROTEIN  Length:140
                                                                                                                                                                            
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh.hhhhh.......hhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tuh E   1 MSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYG 196
                                    10        20     || 86        96       106       116       126       136       146       156       166       176       186       196
                                                    26|                                                                                                                 
                                                     83                                                                                                                 


Chain F from PDB  Type:PROTEIN  Length:146
                                                                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh.....hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tuh F  -3 PLGSMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNN 198
                                     6        16        26|       92       102       112       122       132       142       152       162       172       182       192      
                                                        26|                                                                                                                   
                                                         83                                                                                                                   


Chain G from PDB  Type:PROTEIN  Length:141
                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh.....hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tuh G   0 SMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYG 196
                                     9        19      ||85        95       105       115       125       135       145       155       165       175       185       195 
                                                     26|                                                                                                                 
                                                      83                                                                                                                 


Chain H from PDB  Type:PROTEIN  Length:143
                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh.....hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tuh H  -1 GSMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGN 197
                                     8        18       |84        94       104       114       124       134       144       154       164       174       184       194   
                                                      26|                                                                                                                  
                                                       83
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4TUH)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4TUH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4TUH)

(-) Gene Ontology  (71, 71)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    38H  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4tuh)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4tuh
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B2CL1_HUMAN | Q07817
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B2CL1_HUMAN | Q07817
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        B2CL1_HUMAN | Q07817: 1bxl 1g5j 1g5m 1gjh 1lxl 1maz 1r2d 1r2e 1r2g 1r2h 1r2i 1ysg 1ysi 1ysn 2b48 2lp8 2lpc 2m03 2m04 2me8 2me9 2mej 2o1y 2o21 2o22 2o2m 2o2n 2p1l 2pon 2yj1 2yq6 2yq7 2yxj 3cva 3fdl 3fdm 3inq 3io8 3pl7 3qkd 3r85 3sp7 3spf 3wiz 3zk6 3zln 3zlo 3zlr 4a1u 4a1w 4aq3 4bpk 4c52 4c5d 4cin 4ehr 4hnj 4ieh 4ppi 4qve 4qvf 4qvx 4z9v 5agw 5agx 5b1z 5c3g 5fmj 5fmk

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4TUH)