Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF BCL-XL COMPLEX WITH 4-(5-BUTYL-3-(HYDROXYMETHYL)-1-PHENYL-1H-PYRAZOL-4-YL)-3-(3,4-DIHYDRO-2(1H)-ISOQUINOLINYLCARBONYL)-N-((2-(TRIMETHYLSILYL)ETHYL)SULFONYL)BENZAMIDE
 
Authors :  G. M. Schroeder, D. Wei, P. Banfi, Z. Cai, J. Lippy, M. Menichincheri, M. J. Naglich, B. Penhallow, H. L. Perez, J. Sack, R. J. Schmidt, A. Tebben L. Zhang, A. Galvani, L. J. Lombardo, R. M. Borzilleri
Date :  03 Apr 12  (Deposition) - 06 Jun 12  (Release) - 13 Jun 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.09
Chains :  Asym./Biol. Unit :  A
Keywords :  Apoptosis, Programmed Cell Death, Bcl-2 Family (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. M. Schroeder, D. Wei, P. Banfi, Z. W. Cai, J. Lippy, M. Menichincheri M. Modugno, J. Naglich, B. Penhallow, H. L. Perez, J. Sack, R. J. Schmidt, A. Tebben, C. Yan, L. Zhang, A. Galvani, L. J. Lombardo, R. M. Borzilleri
Pyrazole And Pyrimidine Phenylacylsulfonamides As Dual Bcl-2/Bcl-Xl Antagonists.
Bioorg. Med. Chem. Lett. V. 22 3951 2012
PubMed-ID: 22608393  |  Reference-DOI: 10.1016/J.BMCL.2012.04.106

(-) Compounds

Molecule 1 - BCL-2-LIKE PROTEIN 1
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET29B
    Expression System StrainHMS174 (DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 1-209
    GeneBCL2L1, BCL2L, BCLX
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymBCL2-L-1, APOPTOSIS REGULATOR BCL-X

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
10Q51Ligand/Ion4-[5-BUTYL-3-(HYDROXYMETHYL)-1-PHENYL-1H-PYRAZOL-4-YL]-3-(3,4-DIHYDROISOQUINOLIN-2(1H)-YLCARBONYL)-N-{[2-(TRIMETHYLSILYL)ETHYL]SULFONYL}BENZAMIDE
2IMD1Ligand/IonIMIDAZOLE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:25 , GLN A:26 , PHE A:97 , ARG A:100 , TYR A:101 , ALA A:104 , PHE A:105 , GLU A:129 , LEU A:130 , GLY A:138 , ARG A:139 , PHE A:146BINDING SITE FOR RESIDUE 0Q5 A 301
2AC2SOFTWAREGLN A:26 , VAL A:163BINDING SITE FOR RESIDUE IMD A 302

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4EHR)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Trp A:24 -Ser A:25
2Ser A:25 -Gln A:26

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4EHR)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4EHR)

(-) Exons   (0, 0)

(no "Exon" information available for 4EHR)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:139
                                                                                                                                                                           
               SCOP domains d4ehra_ A: Apoptosis regulator Bcl-xL                                                                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ehr A   2 SQSNRELVVDFLSYKLSQKGYSWSQSEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYG 196
                                    11        21    ||  87        97       107       117       127       137       147       157       167       177       187         
                                                   26|                                                                                                                 
                                                    83                                                                                                                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4EHR)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4EHR)

(-) Gene Ontology  (71, 71)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    0Q5  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IMD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser A:25 - Gln A:26   [ RasMol ]  
    Trp A:24 - Ser A:25   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4ehr
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B2CL1_HUMAN | Q07817
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  B2CL1_HUMAN | Q07817
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        B2CL1_HUMAN | Q078171bxl 1g5j 1g5m 1gjh 1lxl 1maz 1r2d 1r2e 1r2g 1r2h 1r2i 1ysg 1ysi 1ysn 2b48 2lp8 2lpc 2m03 2m04 2me8 2me9 2mej 2o1y 2o21 2o22 2o2m 2o2n 2p1l 2pon 2yj1 2yq6 2yq7 2yxj 3cva 3fdl 3fdm 3inq 3io8 3pl7 3qkd 3r85 3sp7 3spf 3wiz 3zk6 3zln 3zlo 3zlr 4a1u 4a1w 4aq3 4bpk 4c52 4c5d 4cin 4hnj 4ieh 4ppi 4qve 4qvf 4qvx 4tuh 4z9v 5agw 5agx 5b1z 5c3g 5fmj 5fmk

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4EHR)