3QRF - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:DNA  Length:21
                                                      
                3qrf A 4001 TTAGGAAAATTTGTTTCATAG 4021
                                  4010      4020

Chain B from PDB  Type:DNA  Length:21
                                                      
                3qrf B 5001 AACTATGAAACAAATTTTCCT 5021
                                  5010      5020

Chain C from PDB  Type:DNA  Length:21
                                                      
                3qrf C 4001 TTAGGAAAATTTGTTTCATAG 4021
                                  4010      4020

Chain D from PDB  Type:DNA  Length:21
                                                      
                3qrf D 5001 AACTATGAAACAAATTTTCCT 5021
                                  5010      5020

Chain F from PDB  Type:PROTEIN  Length:82
 aligned with FOXP3_HUMAN | Q9BZS1 from UniProtKB/Swiss-Prot  Length:431

    Alignment length:82
                                   345       355       365       375       385       395       405       415  
         FOXP3_HUMAN    336 MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKR  417
               SCOP domains d3qrff_ F: automated matches                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhh......hhhhhhhhhhhhhh.......hhhhhhhhhhhhh..eeee......eeeehhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------V-------C------------T------------W-------------------- SAPs(SNPs)
                PROSITE (1) -FORK_HEAD_3  PDB: F:337-417 UniProt: 337-423                                      PROSITE (1)
                PROSITE (2) ---------------------------------------------FORK_HE------------------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                3qrf F  336 MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKR  417
                                   345       355       365       375       385       395       405       415

Chain G from PDB  Type:PROTEIN  Length:82
 aligned with FOXP3_HUMAN | Q9BZS1 from UniProtKB/Swiss-Prot  Length:431

    Alignment length:82
                                   345       355       365       375       385       395       405       415  
         FOXP3_HUMAN    336 MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKR  417
               SCOP domains d3qrfg_ G: automated matches                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhh....eehhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..eeee......eeee......... Sec.struct. author
                 SAPs(SNPs) ---------------------------V-------C------------T------------W-------------------- SAPs(SNPs)
                PROSITE (1) -FORK_HEAD_3  PDB: G:337-417 UniProt: 337-423                                      PROSITE (1)
                PROSITE (2) ---------------------------------------------FORK_HE------------------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                3qrf G  336 MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKR  417
                                   345       355       365       375       385       395       405       415

Chain H from PDB  Type:PROTEIN  Length:82
 aligned with FOXP3_HUMAN | Q9BZS1 from UniProtKB/Swiss-Prot  Length:431

    Alignment length:82
                                   345       355       365       375       385       395       405       415  
         FOXP3_HUMAN    336 MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKR  417
               SCOP domains d3qrfh_ H: automated matches                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhh......hhhhhhhhhhhhhh.......hhhhhhhhhhhhh..eeee......eeeehhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------V-------C------------T------------W-------------------- SAPs(SNPs)
                PROSITE (1) -FORK_HEAD_3  PDB: H:337-417 UniProt: 337-423                                      PROSITE (1)
                PROSITE (2) ---------------------------------------------FORK_HE------------------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                3qrf H  336 MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKR  417
                                   345       355       365       375       385       395       405       415

Chain I from PDB  Type:PROTEIN  Length:82
 aligned with FOXP3_HUMAN | Q9BZS1 from UniProtKB/Swiss-Prot  Length:431

    Alignment length:82
                                   345       355       365       375       385       395       405       415  
         FOXP3_HUMAN    336 MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKR  417
               SCOP domains d3qrfi_ I: automated matches                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -Fork_head-3qrfI01 I:337-417                                                       Pfam domains (1)
           Pfam domains (2) -Fork_head-3qrfI02 I:337-417                                                       Pfam domains (2)
           Pfam domains (3) -Fork_head-3qrfI03 I:337-417                                                       Pfam domains (3)
           Pfam domains (4) -Fork_head-3qrfI04 I:337-417                                                       Pfam domains (4)
         Sec.struct. author .....hhhhhhhhhhhh....eehhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..eeee......eeee......... Sec.struct. author
                 SAPs(SNPs) ---------------------------V-------C------------T------------W-------------------- SAPs(SNPs)
                PROSITE (1) -FORK_HEAD_3  PDB: I:337-417 UniProt: 337-423                                      PROSITE (1)
                PROSITE (2) ---------------------------------------------FORK_HE------------------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------- Transcript
                3qrf I  336 MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKR  417
                                   345       355       365       375       385       395       405       415

Chain M from PDB  Type:PROTEIN  Length:286
 aligned with NFAC2_HUMAN | Q13469 from UniProtKB/Swiss-Prot  Length:925

    Alignment length:286
                                   402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672      
         NFAC2_HUMAN    393 SLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV  678
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........ee..ee.eeee........ee.................eee.........eeeeeeee............eeeee..........eeeee..eeeeeeeehhhhh.eee...eeeee.hhhhhhh............eeeeeeeee.........eee.....ee.hhhhhhhh.........eee.....eeeee.........eeeeee.....eeeeee...........eeeee.............eeeeee............eeee.. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------R---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4  PDB: M:393-444 UniProt: 387-444           Exon 1.5  PDB: M:445-512 UniProt: 445-512                           ---------------------------------------------------------Exon 1.7  PDB: M:570-617 UniProt: 570-617       ------------------------------------------------------------1 Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------Exon 1.6  PDB: M:512-570 UniProt: 512-570                  ----------------------------------------------Exon 1.8           Exon 1.9  PDB: M:636-678 UniProt: 636-678   Transcript 1 (2)
                3qrf M  393 SSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVAAAAAAPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV  678
                                   402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672

Chain N from PDB  Type:PROTEIN  Length:286
 aligned with NFAC2_HUMAN | Q13469 from UniProtKB/Swiss-Prot  Length:925

    Alignment length:286
                                   402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672      
         NFAC2_HUMAN    393 SLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV  678
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----------------RHD-3qrfN03 N:410-570                                                                                                                                            -----------TIG-3qrfN01 N:582-675                                                                         --- Pfam domains (1)
           Pfam domains (2) -----------------RHD-3qrfN04 N:410-570                                                                                                                                            -----------TIG-3qrfN02 N:582-675                                                                         --- Pfam domains (2)
         Sec.struct. author ...........ee..ee.eeee........ee.................eee.........eeeeeeee............eeeee..........eeeee..eeeeeeeehhhhh.eee...eeeee.hhhhhhh............eeeeeeeee.........eee.....ee.hhhhhhhh.........eee.....eeeee.........eeeeee.....eeeeee...........eeeee.............eeeeee............eeee.. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------R---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4  PDB: N:393-444 UniProt: 387-444           Exon 1.5  PDB: N:445-512 UniProt: 445-512                           ---------------------------------------------------------Exon 1.7  PDB: N:570-617 UniProt: 570-617       ------------------------------------------------------------1 Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------Exon 1.6  PDB: N:512-570 UniProt: 512-570                  ----------------------------------------------Exon 1.8           Exon 1.9  PDB: N:636-678 UniProt: 636-678   Transcript 1 (2)
                3qrf N  393 SSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVAAAAAAPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV  678
                                   402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain F,G,H,I (FOXP3_HUMAN | Q9BZS1)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0051059	NF-kappaB binding	Interacting selectively and non-covalently with NF-kappaB, a transcription factor for eukaryotic RNA polymerase II promoters.
	GO:0051525	NFAT protein binding	Interacting selectively and non-covalently with NFAT (nuclear factor of activated T cells) proteins, a family of transcription factors. NFAT proteins have crucial roles in the development and function of the immune system.
	GO:0000981	RNA polymerase II transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription by RNA polymerase II. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0001047	core promoter binding	Interacting selectively and non-covalently with the regulatory region composed of the transcription start site and binding sites for the basal transcription machinery. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
	GO:0035035	histone acetyltransferase binding	Interacting selectively and non-covalently with the enzyme histone acetyltransferase.
	GO:0042826	histone deacetylase binding	Interacting selectively and non-covalently with the enzyme histone deacetylase.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0003714	transcription corepressor activity	Interacting selectively and non-covalently with a repressing transcription factor and also with the basal transcription machinery in order to stop, prevent, or reduce the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between repressive transcription factors and the basal transcription machinery.
	GO:0003705	transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding	Interacting selectively and non-covalently with a sequence of DNA that is in a distal enhancer region for RNA polymerase II (RNAP II) in order to modulate transcription by RNAP II.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
	GO:0001782	B cell homeostasis	The process of regulating the proliferation and elimination of B cells such that the total number of B cells within a whole or part of an organism is stable over time in the absence of an outside stimulus.
	GO:0002361	CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	The process in which a precursor cell type acquires the specialized features of a CD4-positive, CD25-positive, alpha-beta regulatory T cell.
	GO:0002362	CD4-positive, CD25-positive, alpha-beta regulatory T cell lineage commitment	The process in which a CD4-positive, alpha-beta T cell becomes committed to becoming a CD4-positive, CD25-positive, alpha-beta regulatory T cell.
	GO:0042110	T cell activation	The change in morphology and behavior of a mature or immature T cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
	GO:0043029	T cell homeostasis	The process of regulating the proliferation and elimination of T cells such that the total number of T cells within a whole or part of an organism is stable over time in the absence of an outside stimulus.
	GO:0002456	T cell mediated immunity	Any process involved in the carrying out of an immune response by a T cell.
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0006338	chromatin remodeling	Dynamic structural changes to eukaryotic chromatin occurring throughout the cell division cycle. These changes range from the local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation.
	GO:0001816	cytokine production	The appearance of a cytokine due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels.
	GO:0002262	myeloid cell homeostasis	The process of regulating the proliferation and elimination of myeloid cells such that the total number of myeloid cells within a whole or part of an organism is stable over time in the absence of an outside stimulus.
	GO:0032792	negative regulation of CREB transcription factor activity	Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of the transcription factor CREB.
	GO:0032088	negative regulation of NF-kappaB transcription factor activity	Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of the transcription factor NF-kappaB.
	GO:0002725	negative regulation of T cell cytokine production	Any process that stops, prevents, or reduces the frequency, rate, or extent of T cell cytokine production.
	GO:0042130	negative regulation of T cell proliferation	Any process that stops, prevents or reduces the rate or extent of T cell proliferation.
	GO:2000320	negative regulation of T-helper 17 cell differentiation	Any process that stops, prevents or reduces the frequency, rate or extent of T-helper 17 cell differentiation.
	GO:0046007	negative regulation of activated T cell proliferation	Any process that stops, prevents or reduces the rate or extent of activated T cell proliferation.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0002677	negative regulation of chronic inflammatory response	Any process that stops, prevents, or reduces the frequency, rate, or extent of a chronic inflammatory response.
	GO:0042036	negative regulation of cytokine biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of cytokines.
	GO:0050710	negative regulation of cytokine secretion	Any process that stops, prevents, or reduces the frequency, rate or extent of the regulated release of cytokines from a cell.
	GO:0035067	negative regulation of histone acetylation	Any process that stops, prevents, or reduces the frequency, rate or extent of the addition of an acetyl group to a histone protein.
	GO:0031064	negative regulation of histone deacetylation	Any process that stops, prevents, or reduces the frequency, rate or extent of the removal of acetyl groups from histones.
	GO:0050777	negative regulation of immune response	Any process that stops, prevents, or reduces the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
	GO:0050728	negative regulation of inflammatory response	Any process that stops, prevents, or reduces the frequency, rate or extent of the inflammatory response.
	GO:0045077	negative regulation of interferon-gamma biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of interferon-gamma.
	GO:0032689	negative regulation of interferon-gamma production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interferon-gamma production. Interferon-gamma is also known as type II interferon.
	GO:0032693	negative regulation of interleukin-10 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-10 production.
	GO:0032700	negative regulation of interleukin-17 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of production of any member of the interleukin-17 family of cytokines.
	GO:0045085	negative regulation of interleukin-2 biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of interleukin-2.
	GO:0032703	negative regulation of interleukin-2 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-2 production.
	GO:0032713	negative regulation of interleukin-4 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-4 production.
	GO:0032714	negative regulation of interleukin-5 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-5 production.
	GO:0032715	negative regulation of interleukin-6 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-6 production.
	GO:0048294	negative regulation of isotype switching to IgE isotypes	Any process that stops, prevents, or reduces the frequency, rate or extent of isotype switching to IgE isotypes.
	GO:0050672	negative regulation of lymphocyte proliferation	Any process that stops, prevents or reduces the rate or extent of lymphocyte proliferation.
	GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity	Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0032720	negative regulation of tumor necrosis factor production	Any process that stops, prevents, or reduces the frequency, rate, or extent of tumor necrosis factor production.
	GO:0032831	positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	Any process that activates or increases the frequency, rate or extent of differentiation of CD4-positive, CD25-positive, alpha-beta regulatory T cells.
	GO:0002669	positive regulation of T cell anergy	Any process that activates or increases the frequency, rate, or extent of T cell anergy.
	GO:0002666	positive regulation of T cell tolerance induction	Any process that activates or increases the frequency, rate, or extent of T cell tolerance induction.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0035066	positive regulation of histone acetylation	Any process that activates or increases the frequency, rate or extent of the addition of an acetyl group to a histone protein.
	GO:0033092	positive regulation of immature T cell proliferation in thymus	Any process that activates or increases the frequency, rate or extent of immature T cell proliferation in the thymus.
	GO:0032753	positive regulation of interleukin-4 production	Any process that activates or increases the frequency, rate, or extent of interleukin-4 production.
	GO:0002851	positive regulation of peripheral T cell tolerance induction	Any process that activates or increases the frequency, rate, or extent of peripheral T cell tolerance induction.
	GO:0045591	positive regulation of regulatory T cell differentiation	Any process that activates or increases the frequency, rate or extent of differentiation of regulatory T cells.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0032914	positive regulation of transforming growth factor beta1 production	Any process that activates or increases the frequency, rate, or extent of production of transforming growth factor-beta1.
	GO:0002667	regulation of T cell anergy	Any process that modulates the frequency, rate, or extent of T cell anergy.
	GO:0002637	regulation of immunoglobulin production	Any process that modulates the frequency, rate, or extent of immunoglobulin production.
	GO:0048302	regulation of isotype switching to IgG isotypes	Any process that modulates the frequency, rate or extent of isotype switching to IgG isotypes.
	GO:0006357	regulation of transcription from RNA polymerase II promoter	Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0045066	regulatory T cell differentiation	The process in which a relatively unspecialized T cell acquires specialized features of a regulatory T cell. Regulatory T cells control or suppress immune responses through a variety of mechanisms and subsets include the CD4+CD25+ cell type as well as certain CD8+ cell types.
	GO:0009615	response to virus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from a virus.
	GO:0002507	tolerance induction	A process that directly activates any of the steps required for tolerance, a physiologic state in which the immune system does not react destructively against the components of an organism that harbors it or against antigens that are introduced to it.
	GO:0002513	tolerance induction to self antigen	Tolerance induction directed at self antigens.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Chain M,N (NFAC2_HUMAN | Q13469)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II.
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0044212	transcription regulatory region DNA binding	Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
	GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding	Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
	GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding	Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to stop, prevent, or reduce the frequency, rate or extent of transcription from an RNA polymerase II promoter.
biological process
	GO:0050853	B cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a B cell.
	GO:0038095	Fc-epsilon receptor signaling pathway	A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
	GO:0033173	calcineurin-NFAT signaling cascade	Any intracellular signal transduction in which the signal is passed on within the cell by activation of a member of the NFAT protein family as a consequence of NFAT dephosphorylation by Ca(2+)-activated calcineurin. The cascade begins with calcium-dependent activation of the phosphatase calcineurin. Calcineurin dephosphorylates multiple phosphoserine residues on NFAT, resulting in the translocation of NFAT to the nucleus. The cascade ends with regulation of transcription by NFAT. The calcineurin-NFAT cascade lies downstream of many cell surface receptors, including G-protein coupled receptors (GPCRs) and receptor tyrosine kinases (RTKs) that signal to mobilize calcium ions (Ca2+).
	GO:0016477	cell migration	The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0001816	cytokine production	The appearance of a cytokine due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels.
	GO:0014904	myotube cell development	The process aimed at the progression of a myotube cell over time, from initial commitment of the cell to a specific fate, to the fully functional differentiated cell. Myotubes are multinucleated cells that are formed when proliferating myoblasts exit the cell cycle, differentiate and fuse.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0030890	positive regulation of B cell proliferation	Any process that activates or increases the rate or extent of B cell proliferation.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:1901741	positive regulation of myoblast fusion	Any process that activates or increases the frequency, rate or extent of myoblast fusion.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0044798	nuclear transcription factor complex	A protein complex, located in the nucleus, that is capable of associating with DNA by direct binding, or via other DNA-binding proteins or complexes, and regulating transcription.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0005667	transcription factor complex	A protein complex that is capable of associating with DNA by direct binding, or via other DNA-binding proteins or complexes, and regulating transcription.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (5, 18)

PROSITE Motifs (2, 8)

Exons (7, 14)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (3, 8)

Gene Ontology (103, 116)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File