|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (4, 11)
|
Asymmetric Unit (11, 11)
|
(no "SS Bond" information available for 3V3X) |
(no "Cis Peptide Bond" information available for 3V3X) |
(no "SAP(SNP)/Variant" information available for 3V3X) |
(no "PROSITE Motif" information available for 3V3X) |
(no "Exon" information available for 3V3X) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:56 aligned with SPG2_STRSG | P19909 from UniProtKB/Swiss-Prot Length:593 Alignment length:56 311 321 331 341 351 SPG2_STRSG 302 DTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE 357 SCOP domains d3v3xa_ A: SCOP domains CATH domains -------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------- PROSITE Transcript -------------------------------------------------------- Transcript 3v3x A 1 MQYKLILCGKTLKGETTTEAVDAATAECVFKQYANDNGVDGEWTYDDATKTFTVTE 56 10 20 30 40 50 Chain B from PDB Type:PROTEIN Length:56 aligned with SPG2_STRSG | P19909 from UniProtKB/Swiss-Prot Length:593 Alignment length:56 311 321 331 341 351 SPG2_STRSG 302 DTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE 357 SCOP domains d3v3xb_ B: SCOP domains CATH domains -------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------- PROSITE Transcript -------------------------------------------------------- Transcript 3v3x B 1 MQYKLILCGKTLKGETTTEAVDAATAECVFKQYANDNGVDGEWTYDDATKTFTVTE 56 10 20 30 40 50 Chain C from PDB Type:PROTEIN Length:56 aligned with SPG2_STRSG | P19909 from UniProtKB/Swiss-Prot Length:593 Alignment length:56 311 321 331 341 351 SPG2_STRSG 302 DTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE 357 SCOP domains d3v3xc_ C: SCOP domains CATH domains -------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------- PROSITE Transcript -------------------------------------------------------- Transcript 3v3x C 1 MQYKLILCGKTLKGETTTEAVDAATAECVFKQYANDNGVDGEWTYDDATKTFTVTE 56 10 20 30 40 50 Chain D from PDB Type:PROTEIN Length:56 aligned with SPG2_STRSG | P19909 from UniProtKB/Swiss-Prot Length:593 Alignment length:56 311 321 331 341 351 SPG2_STRSG 302 DTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE 357 SCOP domains d3v3xd_ D: SCOP domains CATH domains -------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------- PROSITE Transcript -------------------------------------------------------- Transcript 3v3x D 1 MQYKLILCGKTLKGETTTEAVDAATAECVFKQYANDNGVDGEWTYDDATKTFTVTE 56 10 20 30 40 50
|
Asymmetric Unit |
(no "CATH Domain" information available for 3V3X) |
(no "Pfam Domain" information available for 3V3X) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D (SPG2_STRSG | P19909)
|
|
|
|
|
|
|