1QKZ - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:58
 aligned with Q54181_STRSG | Q54181 from UniProtKB/TrEMBL  Length:185

    Alignment length:58
                                    68        78        88        98       108        
        Q54181_STRSG     59 VTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK  116
               SCOP domains d1qkza_ A:                                                 SCOP domains
               CATH domains 1qkzA00 A:5-62  [code=3.10.20.10, no name defined]         CATH domains
               Pfam domains --IgG_binding_B-1qkzA01 A:7-61                           - Pfam domains
         Sec.struct. author .eeeeeeee....eeeeeeee.hhhhhhhhhhhhhhhh....eeeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------- Transcript
                1qkz A    5 VTTYKLVINGKTLKGETTTKAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK   62
                                    14        24        34        44        54

Chain A from PDB  Type:PROTEIN  Length:58
 aligned with SPG2_STRSG | P19909 from UniProtKB/Swiss-Prot  Length:593

    Alignment length:58
                                   380       390       400       410       420        
          SPG2_STRSG    371 VTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK  428
               SCOP domains d1qkza_ A:                                                 SCOP domains
               CATH domains 1qkzA00 A:5-62  [code=3.10.20.10, no name defined]         CATH domains
               Pfam domains --IgG_binding_B-1qkzA01 A:7-61                           - Pfam domains
         Sec.struct. author .eeeeeeee....eeeeeeee.hhhhhhhhhhhhhhhh....eeeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------- Transcript
                1qkz A    5 VTTYKLVINGKTLKGETTTKAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEK   62
                                    14        24        34        44        54

Chain H from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                            
               SCOP domains d1qkzh1 H:1-113 Immunoglobulin heavy chain variable domain, VH                                                         d1qkzh2 H:114-213 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma                      SCOP domains
               CATH domains 1qkzH01 H:1-113 Immunoglobulins                                                                                        1qkzH02 H:114-212 Immunoglobulins                                                                  - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..........eeeeeeee..hhhhh.eeeeee.....eeeeeee................eeeeee....eeeeee...hhhhheeeeeee..............eee..........eeeee...........eeeeeeeeee.....eeee.hhh....eee.........eeeeeeeee..........eeeeeehhhheeeeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1qkz H    1 DVKLVESGGGLVKPGRSLKLSCAASGFTFSDYYMFWVRQTPEQRLEWVATISDGGAYTYYPDSVKGRFTISRDNAKNNLYLQMNSLKSEDTGMYYCARDPLEYYGMDYWGQGTSVAVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVNVTSSTWPSQSITCNVAHPASSTKVDKKIVPR  213
                                    10        20        30        40        50  |     59        69        79   |||  86        96    || 104       114       124       134       144       154       164       174       184       194       204         
                                                                              52A                            82A||               100A|                                                                                                                 
                                                                                                              82B|                100B                                                                                                                 
                                                                                                               82C

Chain L from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                       
               SCOP domains d1qkzl1 L:1-107 Immunoglobulin light chain kappa variable domain, VL-kappa                                     d1qkzl2 L:108-213 Immunoglobulin light chain kappa constant domain, CL-kappa                            SCOP domains
               CATH domains 1qkzL01 L:1-108 Immunoglobulins                                                                                 1qkzL02 L:109-211 Immunoglobulins                                                                   -- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee..eeee.....eeeeeee............eeeeee......eeee.............eeeeee..eeeeee...hhhhheeeeeee..........eeeee.......eeeee..hhhhhhhheeeeeeeee.......eeeeee..eee...eeeee........eeeeeeeehhhhh...eeeeeee.......eeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1qkz L    1 NIVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHFPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGKERQNGVLNSWTDQDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE  213
                                    10        20       27C||      35        45        55        65        75        85        95|      106       116       126       136       146       156       166|      179       189       199       209    
                                                     27A||||                                                                  95|                                                                  166|                                           
                                                      27B|||                                                                   97                                                                   170                                           
                                                       27C||                                                                                                                                                                                      
                                                        27D|                                                                                                                                                                                      
                                                         27E

Chain P from PDB  Type:PROTEIN  Length:10
 aligned with OMPA_NEIMA | P57041 from UniProtKB/Swiss-Prot  Length:395

    Alignment length:10
                                    55
          OMPA_NEIMA     46 ANGGASGQVK   55
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
               Pfam domains ---------- Pfam domains
         Sec.struct. author .......... Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
                 Transcript ---------- Transcript
                1qkz P    1 ANGGASGQVK   10
                                    10

Chain P from PDB  Type:PROTEIN  Length:10
 aligned with Q06140_NEIME | Q06140 from UniProtKB/TrEMBL  Length:19

    Alignment length:10
                                    13
        Q06140_NEIME      4 ANGGASGQVK   13
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
               Pfam domains ---------- Pfam domains
         Sec.struct. author .......... Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
                 Transcript ---------- Transcript
                1qkz P    1 ANGGASGQVK   10
                                    10

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (5, 5)

CATH Domains (2, 5)

Pfam Domains (1, 1)

Gene Ontology (12, 14)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (SPG2_STRSG | P19909)

molecular function
	GO:0019864	IgG binding	Interacting selectively and non-covalently with an immunoglobulin of an IgG isotype.
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005618	cell wall	The rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal, most prokaryotic cells and some protozoan parasites, maintaining their shape and protecting them from osmotic lysis. In plants it is made of cellulose and, often, lignin; in fungi it is composed largely of polysaccharides; in bacteria it is composed of peptidoglycan; in protozoan parasites such as Giardia species, it's made of carbohydrates and proteins.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain A (Q54181_STRSG | Q54181)

cellular component
	GO:0005618		cell wall		The rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal, most prokaryotic cells and some protozoan parasites, maintaining their shape and protecting them from osmotic lysis. In plants it is made of cellulose and, often, lignin; in fungi it is composed largely of polysaccharides; in bacteria it is composed of peptidoglycan; in protozoan parasites such as Giardia species, it's made of carbohydrates and proteins.

Chain P (Q06140_NEIME | Q06140)

Chain P (OMPA_NEIMA | P57041)

molecular function
	GO:0015288	porin activity	Catalysis of the transfer of substances, sized less than 1000 Da, from one side of the membrane to the other. The transmembrane portions of porins consist exclusively of beta-strands which form a beta-barrel. They are found in the outer membranes of Gram-negative bacteria, mitochondria, plastids and possibly acid-fast Gram-positive bacteria.
biological process
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0055085	transmembrane transport	The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0009279	cell outer membrane	A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0046930	pore complex	Any small opening in a membrane that allows the passage of gases and/or liquids.

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1qkz
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	OMPA_NEIMA \| P57041
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	Q06140_NEIME \| Q06140
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	Q54181_STRSG \| Q54181
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	SPG2_STRSG \| P19909
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (4, 4)

Cis Peptide Bonds (5, 5)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments