Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  1H, 13C, AND 15N CHEMICAL SHIFT ASSIGNMENTS FOR IN VITRO GB1
 
Authors :  T. Ikeya, T. Hanashima, S. Hosoya, M. Shimazaki, S. Ikeda, M. Mishima, P. Guentert, Y. Ito
Date :  26 Nov 15  (Deposition) - 28 Dec 16  (Release) - 28 Dec 16  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  In-Cell Nmr, Protein G B1, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Ikeya, T. Hanashima, S. Hosoya, M. Shimazaki, S. Ikeda, M. Mishima, P. Guentert, Y. Ito
Improved In-Cell Structure Determination Of Proteins At Near-Physiological Concentration
Sci Rep V. 6 38312 2016
PubMed-ID: 27910948  |  Reference-DOI: 10.1038/SREP38312

(-) Compounds

Molecule 1 - IMMUNOGLOBULIN G-BINDING PROTEIN G
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector: PET47B
    Expression System Vector Type: VECTOR
    Fragment: UNP RESIDUES 303-357
    Gene: SPG
    Organism Scientific: STREPTOCOCCUS SP. 'GROUP G'
    Organism Taxid: 1320
    Synonym: IGG-BINDING PROTEIN G

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2N9K)

(-) Sites  (0, 0)

(no "Site" information available for 2N9K)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2N9K)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2N9K)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2N9K)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2N9K)

(-) Exons   (0, 0)

(no "Exon" information available for 2N9K)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:57
                                                                                        
               SCOP domains --------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee....eeeeeee..hhhhhhhhhhhhhhhh....eeeee....eeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------- Transcript
                  2n9k A  1 MGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE 57
                                    10        20        30        40        50
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2N9K)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2N9K)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2N9K)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2n9k)
 
  Sites
(no "Sites" information available for 2n9k)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2n9k)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2n9k
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SPG2_STRSG | P19909
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SPG2_STRSG | P19909
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SPG2_STRSG | P19909: 1fcc 1fcl 1fd6 1gb4 1gjs 1gjt 1ibx 1p7e 1p7f 1qkz 1uwx 1zxh 2gi9 2i2y 2i38 2igg 2jsv 2ju6 2khu 2khw 2kn4 2kq4 2kwd 2lum 2n9l 2oed 2on8 2onq 2plp 2qmt 3fil 3ui3 3v3x 4oza 4ozb 4ozc 4wh4 5bmg 5bmh 5bmi 5hfy 5hg2 5hi1

(-) Related Entries Specified in the PDB File

2n9l