2LOB - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   PDZ DOMAIN OF CAL (CYSTIC FIBROSIS TRANSMEMBRANE REGULATOR-ASSOCIATED LIGAND)

Authors :   A. Piserchio, A. Fellows, D. R. Madden, D. F. Mierke

Date :   20 Jan 12 (Deposition) - 13 Jun 12 (Release) - 13 Jun 12 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B  (7x)
NMR Structure *: A,B  (1x)

Keywords :   Structural Protein-Hydrolase Complex, Peptide Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Piserchio, A. Fellows, D. R. Madden, D. F. Mierke
Association Of The Cystic Fibrosis Transmembrane Regulator With Cal: Structural Features And Molecular Dynamics.
Biochemistry V. 44 16158 2005
PubMed-ID: 16331976

Molecule 1 - GOLGI-ASSOCIATED PDZ AND COILED-COIL MOTIF-CONTAINING PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Expression System Vector	:	PHCALP5
	Fragment	:	PDZ DOMAIN RESIDUES 286-370
	Gene	:	GOPC, CAL, FIG
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CFTR-ASSOCIATED LIGAND, FUSED IN GLIOBLASTOMA, PDZ PROTEIN INTERACTING SPECIFICALLY WITH TC10, PIST

Molecule 2 - CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE REGULATOR
	Chains	:	B
	EC Number	:	3.6.3.49
	Engineered	:	YES
	Fragment	:	PDZ-BINDING MOTIF RESIDUES 1473-1480
	Synonym	:	CFTR, ATP-BINDING CASSETTE SUB-FAMILY C MEMBER 7, CHANNEL CONDUCTANCE-CONTROLLING ATPASE, CAMP-DEPENDENT CHLORIDE CHANNEL

		1	2
NMR Structure (7x)	:	A	B
NMR Structure * (1x)	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2LOB)

(no "Site" information available for 2LOB)

(no "SS Bond" information available for 2LOB)

(no "Cis Peptide Bond" information available for 2LOB)

(no "SAP(SNP)/Variant" information available for 2LOB)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PDZ	PS50106	PDZ domain profile.	GOPC_HUMAN	288-371	1	A:30-112

NMR Structure * (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PDZ	PS50106	PDZ domain profile.	GOPC_HUMAN	288-371	1	A:30-112

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3a	ENST00000003084	3a	ENSE00001343851	chr7:117120017-117120201	185	CFTR_HUMAN	1-18	18	0	-	-
1.4	ENST00000003084	4	ENSE00001708957	chr7:117144307-117144417	111	CFTR_HUMAN	18-55	38	0	-	-
1.5	ENST00000003084	5	ENSE00001778965	chr7:117149088-117149196	109	CFTR_HUMAN	55-91	37	0	-	-
1.6b	ENST00000003084	6b	ENSE00000718611	chr7:117170953-117171168	216	CFTR_HUMAN	92-163	72	0	-	-
1.7	ENST00000003084	7	ENSE00000718620	chr7:117174330-117174419	90	CFTR_HUMAN	164-193	30	0	-	-
1.8	ENST00000003084	8	ENSE00000718626	chr7:117175302-117175465	164	CFTR_HUMAN	194-248	55	0	-	-
1.9	ENST00000003084	9	ENSE00000718630	chr7:117176602-117176727	126	CFTR_HUMAN	248-290	43	0	-	-
1.10	ENST00000003084	10	ENSE00000718634	chr7:117180154-117180400	247	CFTR_HUMAN	290-372	83	0	-	-
1.11	ENST00000003084	11	ENSE00000718637	chr7:117182070-117182162	93	CFTR_HUMAN	373-403	31	0	-	-
1.12	ENST00000003084	12	ENSE00001738590	chr7:117188695-117188877	183	CFTR_HUMAN	404-464	61	0	-	-
1.13a	ENST00000003084	13a	ENSE00000718648	chr7:117199518-117199709	192	CFTR_HUMAN	465-528	64	0	-	-
1.15b	ENST00000003084	15b	ENSE00000718654	chr7:117227793-117227887	95	CFTR_HUMAN	529-560	32	0	-	-
1.16	ENST00000003084	16	ENSE00000718660	chr7:117230407-117230493	87	CFTR_HUMAN	560-589	30	0	-	-
1.17	ENST00000003084	17	ENSE00000718666	chr7:117231988-117232711	724	CFTR_HUMAN	589-830	242	0	-	-
1.18	ENST00000003084	18	ENSE00000718674	chr7:117234984-117235112	129	CFTR_HUMAN	831-873	43	0	-	-
1.19	ENST00000003084	19	ENSE00001015963	chr7:117242880-117242917	38	CFTR_HUMAN	874-886	13	0	-	-
1.20	ENST00000003084	20	ENSE00000977441	chr7:117243586-117243836	251	CFTR_HUMAN	886-970	85	0	-	-
1.21	ENST00000003084	21	ENSE00000977442	chr7:117246728-117246807	80	CFTR_HUMAN	970-996	27	0	-	-
1.22	ENST00000003084	22	ENSE00000718690	chr7:117250573-117250723	151	CFTR_HUMAN	997-1047	51	0	-	-
1.23a	ENST00000003084	23a	ENSE00000977443	chr7:117251635-117251862	228	CFTR_HUMAN	1047-1123	77	0	-	-
1.24	ENST00000003084	24	ENSE00000718699	chr7:117254667-117254767	101	CFTR_HUMAN	1123-1156	34	0	-	-
1.25a	ENST00000003084	25a	ENSE00000718704	chr7:117267576-117267824	249	CFTR_HUMAN	1157-1239	83	0	-	-
1.26	ENST00000003084	26	ENSE00000718708	chr7:117282492-117282647	156	CFTR_HUMAN	1240-1291	52	0	-	-
1.27	ENST00000003084	27	ENSE00000718713	chr7:117292896-117292985	90	CFTR_HUMAN	1292-1321	30	0	-	-
1.28	ENST00000003084	28	ENSE00000718718	chr7:117304742-117304914	173	CFTR_HUMAN	1322-1379	58	0	-	-
1.29	ENST00000003084	29	ENSE00000718724	chr7:117305513-117305618	106	CFTR_HUMAN	1379-1414	36	0	-	-
1.30b	ENST00000003084	30b	ENSE00001918100	chr7:117306962-117308715	1754	CFTR_HUMAN	1415-1480	66	1	B:113-120	8

2.1b	ENST00000368498	1b	ENSE00001931189	chr6:117923527-117923167	361	GOPC_HUMAN	1-95	95	0	-	-
2.2	ENST00000368498	2	ENSE00000840039	chr6:117900227-117900063	165	GOPC_HUMAN	96-150	55	0	-	-
2.3	ENST00000368498	3	ENSE00001371009	chr6:117898634-117898611	24	GOPC_HUMAN	151-158	8	0	-	-
2.4	ENST00000368498	4	ENSE00000762781	chr6:117896515-117896340	176	GOPC_HUMAN	159-217	59	0	-	-
2.5a	ENST00000368498	5a	ENSE00000762780	chr6:117894795-117894630	166	GOPC_HUMAN	217-272	56	0	-	-
2.6	ENST00000368498	6	ENSE00002164938	chr6:117892118-117892023	96	GOPC_HUMAN	273-304	32	1	A:27-46 (gaps)	21
2.7	ENST00000368498	7	ENSE00002151421	chr6:117890899-117890735	165	GOPC_HUMAN	305-359	55	1	A:47-101	55
2.8	ENST00000368498	8	ENSE00002152146	chr6:117888197-117888017	181	GOPC_HUMAN	360-420	61	1	A:102-112	11
2.9	ENST00000368498	9	ENSE00001017893	chr6:117884547-117881432	3116	GOPC_HUMAN	420-462	43	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:86
 aligned with GOPC_HUMAN | Q9HD26 from UniProtKB/Swiss-Prot  Length:462

    Alignment length:87
                                   293       303       313       323       333       343       353       363       
          GOPC_HUMAN    284 GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV  370
               SCOP domains --------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .-.eeeeee........eeeeee....eeeeeeee...............eeeeee.........hhhhhhhhhhh..eeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----PDZ  PDB: A:30-112 UniProt: 288-371                                                 PROSITE
               Transcript 2 Exon 2.6 [INCOMPLETE]Exon 2.7  PDB: A:47-101 UniProt: 305-359               Exon 2.8    Transcript 2
                2lob A   27 G-IRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV  112
                            | |     35        45        55        65        75        85        95       105       
                           27 |                                                                                    
                             28

Chain B from PDB  Type:PROTEIN  Length:8
 aligned with CFTR_HUMAN | P13569 from UniProtKB/Swiss-Prot  Length:1480

    Alignment length:8
          CFTR_HUMAN   1473 EEVQDTRL 1480
               SCOP domains -------- SCOP domains
               CATH domains -------- CATH domains
               Pfam domains -------- Pfam domains
         Sec.struct. author .....eee Sec.struct. author
                 SAPs(SNPs) -------- SAPs(SNPs)
                    PROSITE -------- PROSITE
               Transcript 1 1.30b    Transcript 1
                2lob B  113 EEVQDTRL  120

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2LOB)

(no "CATH Domain" information available for 2LOB)

(no "Pfam Domain" information available for 2LOB)

NMR Structure(hide GO term definitions)

Chain A (GOPC_HUMAN | Q9HD26)

molecular function
	GO:0044325	ion channel binding	Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006888	ER to Golgi vesicle-mediated transport	The directed movement of substances from the endoplasmic reticulum (ER) to the Golgi, mediated by COP II vesicles. Small COP II coated vesicles form from the ER and then fuse directly with the cis-Golgi. Larger structures are transported along microtubules to the cis-Golgi.
	GO:0006893	Golgi to plasma membrane transport	The directed movement of substances from the Golgi to the plasma membrane in transport vesicles that move from the trans-Golgi network to the plasma membrane, where they fuse and release their contents by exocytosis.
	GO:0045176	apical protein localization	Any process in which a protein is transported to, or maintained in, apical regions of the cell.
	GO:0043004	cytoplasmic sequestering of CFTR protein	The selective interaction of Cystic Fibrosis Transmembrane conductance Regulator (CFTR) protein with specific molecules in the cytoplasm, thereby inhibiting its transport to the cell membrane.
	GO:0051260	protein homooligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of identical component monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0030660	Golgi-associated vesicle membrane	The lipid bilayer surrounding a vesicle associated with the Golgi apparatus.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0030425	dendrite	A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
	GO:0005765	lysosomal membrane	The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0014069	postsynaptic density of dendrite	An electron dense network of proteins within and adjacent to the postsynaptic membrane of the dendrite of asymetric synapses. Its major components include neurotransmitter receptors and the proteins that spatially and functionally organize them such as anchoring and scaffolding molecules, signaling enzymes and cytoskeletal components.
	GO:0045211	postsynaptic membrane	A specialized area of membrane facing the presynaptic membrane on the tip of the nerve ending and separated from it by a minute cleft (the synaptic cleft). Neurotransmitters cross the synaptic cleft and transmit the signal to the postsynaptic membrane.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0045202	synapse	The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.
	GO:0030140	trans-Golgi network transport vesicle	A vesicle that mediates transport between the trans-Golgi network and other parts of the cell.

Chain B (CFTR_HUMAN | P13569)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016887	ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
	GO:0042626	ATPase activity, coupled to transmembrane movement of substances	Catalysis of the reaction: ATP + H2O = ADP + phosphate, to directly drive the active transport of a substance across a membrane.
	GO:0043225	ATPase-coupled anion transmembrane transporter activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: ATP + H2O + anion(out) = ADP + phosphate + anion(in).
	GO:0030165	PDZ domain binding	Interacting selectively and non-covalently with a PDZ domain of a protein, a domain found in diverse signaling proteins.
	GO:0015106	bicarbonate transmembrane transporter activity	Enables the transfer of bicarbonate from one side of a membrane to the other. Bicarbonate is the hydrogencarbonate ion, HCO3-.
	GO:0005254	chloride channel activity	Enables the facilitated diffusion of a chloride (by an energy-independent process) involving passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
	GO:0019869	chloride channel inhibitor activity	Stops, prevents, or reduces the activity of a chloride channel.
	GO:0017081	chloride channel regulator activity	Modulates the activity of a chloride channel.
	GO:0015108	chloride transmembrane transporter activity	Enables the transfer of chloride ions from one side of a membrane to the other.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0005260	intracellular ATPase-gated chloride channel activity	Enables passage of a chloride ion through a transmembrane channel that opens when intracellular ATP is bound and hydrolysed. Passage is via passive diffusion once the channel is open.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0015701	bicarbonate transport	The directed movement of bicarbonate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0071320	cellular response to cAMP	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
	GO:1902476	chloride transmembrane transport	The directed movement of chloride across a membrane.
	GO:0006821	chloride transport	The directed movement of chloride into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006695	cholesterol biosynthetic process	The chemical reactions and pathways resulting in the formation of cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones.
	GO:0030301	cholesterol transport	The directed movement of cholesterol, cholest-5-en-3-beta-ol, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0051454	intracellular pH elevation	Any process that increases the internal pH of a cell, measured by the concentration of the hydrogen ion.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0060081	membrane hyperpolarization	The process in which membrane potential increases with respect to its steady-state potential, usually from negative potential to a more negative potential. For example, during the repolarization phase of an action potential the membrane potential often becomes more negative or hyperpolarized before returning to the steady-state resting potential.
	GO:1902161	positive regulation of cyclic nucleotide-gated ion channel activity	Any process that activates or increases the frequency, rate or extent of cyclic nucleotide-gated ion channel activity.
	GO:0045921	positive regulation of exocytosis	Any process that activates or increases the frequency, rate or extent of exocytosis.
	GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	Any process that increases the frequency, rate or extent of the regulated release of insulin that contributes to the response of a cell to glucose.
	GO:1902943	positive regulation of voltage-gated chloride channel activity	Any process that activates or increases the frequency, rate or extent of voltage-gated chloride channel activity.
	GO:0007585	respiratory gaseous exchange	The process of gaseous exchange between an organism and its environment. In plants, microorganisms, and many small animals, air or water makes direct contact with the organism's cells or tissue fluids, and the processes of diffusion supply the organism with dioxygen (O2) and remove carbon dioxide (CO2). In larger animals the efficiency of gaseous exchange is improved by specialized respiratory organs, such as lungs and gills, which are ventilated by breathing mechanisms.
	GO:0048240	sperm capacitation	A process required for sperm to reach fertilization competence. Sperm undergo an incompletely understood series of morphological and molecular maturational processes, termed capacitation, involving, among other processes, protein tyrosine phosphorylation and increased intracellular calcium.
	GO:0055085	transmembrane transport	The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0006904	vesicle docking involved in exocytosis	The initial attachment of a vesicle membrane to a target membrane, mediated by proteins protruding from the membrane of the vesicle and the target membrane, that contributes to exocytosis.
cellular component
	GO:0030660	Golgi-associated vesicle membrane	The lipid bilayer surrounding a vesicle associated with the Golgi apparatus.
	GO:0016324	apical plasma membrane	The region of the plasma membrane located at the apical end of the cell.
	GO:0016323	basolateral plasma membrane	The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0034707	chloride channel complex	An ion channel complex through which chloride ions pass.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005769	early endosome	A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
	GO:0031901	early endosome membrane	The lipid bilayer surrounding an early endosome.
	GO:0031205	endoplasmic reticulum Sec complex	An endoplasmic reticulum membrane-associated complex involved in the translocation of proteins that are targeted to the ER. In yeast, this complex consists of two subcomplexes, namely, the Sec61 complex and the Sec62/Sec63 complex.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005765	lysosomal membrane	The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0055037	recycling endosome	An organelle consisting of a network of tubules that functions in targeting molecules, such as receptors transporters and lipids, to the plasma membrane.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2lob)

	Sites
(no "Sites" information available for 2lob)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2lob)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2lob
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CFTR_HUMAN \| P13569
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	GOPC_HUMAN \| Q9HD26
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.6.3.49
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CFTR_HUMAN \| P13569
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	GOPC_HUMAN \| Q9HD26
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 2LOB)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (67, 75)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File