Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  HUMAN CFTR AA389-678 (NBD1), DELTAF508 WITH THREE SOLUBILIZING MUTATIONS, BOUND ATP
 
Authors :  L. J. Byrnes, J. Hall
Date :  18 Nov 14  (Deposition) - 11 Nov 15  (Release) - 10 Feb 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.05
Chains :  Asym./Biol. Unit :  A
Keywords :  Atpase, Hydrolase, Atp/Adp Binding, Atp Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. D. Hall, H. Wang, L. J. Byrnes, S. Shanker, K. Wang, I. V. Efremov, P. A. Chong, J. D. Forman-Kay, A. E. Aulabaugh
Binding Screen For Cystic Fibrosis Transmembrane Conductanc Regulator Correctors Finds New Chemical Matter And Yields Insights Into Cystic Fibrosis Therapeutic Strategy.
Protein Sci. V. 25 360 2016
PubMed-ID: 26444971  |  Reference-DOI: 10.1002/PRO.2821

(-) Compounds

Molecule 1 - CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE REGULATOR
    Chains: A
    EC Number: 3.6.3.49
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 389-678
    Gene: CFTR, ABCC7
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CFTR,ATP-BINDING CASSETTE SUB-FAMILY C MEMBER 7,CHANNEL CONDUCTANCE-CONTROLLING ATPASE,CAMP-DEPENDENT CHLORIDE CHANNEL

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
1ATP1Ligand/IonADENOSINE-5'-TRIPHOSPHATE
2MG1Ligand/IonMAGNESIUM ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETRP A:401 , VAL A:440 , SER A:459 , THR A:460 , GLY A:461 , ALA A:462 , GLY A:463 , LYS A:464 , THR A:465 , SER A:466 , MET A:469 , GLN A:493 , MG A:702 , HOH A:803 , HOH A:805 , HOH A:806 , HOH A:812 , HOH A:813 , HOH A:814 , HOH A:822 , HOH A:831 , HOH A:834binding site for residue ATP A 701
2AC2SOFTWARELYS A:464 , SER A:572 , ATP A:701 , HOH A:834 , HOH A:838binding site for residue MG A 702

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4WZ6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4WZ6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4WZ6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4WZ6)

(-) Exons   (0, 0)

(no "Exon" information available for 4WZ6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:258
                                                                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeeeeee..hhhhhhhhhhhhh.......eeeeeeee....eeeeee....hhhhhhhhhh......eeeee....eeee.........hhhhhhh....hhhhhhhhhhhhhhhhhhhh..hhhhh......hhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhh.........eeee..hhhhhhhh.eeeeee..eeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4wz6 A 389 TTEVVMENVTAFWEEGFGELFEKAKQSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMSFDQFSAERRNSILTETLHRFSLE 671
                                   398       408     ||437       447       457       467       477       487       497       507       517       527       537  ||   550       560       570       580       590       600       610       620       630       640   ||  653       663        
                                                   414|                                                                                                       540|                                                                                                 644|                       
                                                    434                                                                                                        544                                                                                                  648
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4WZ6)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4WZ6)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4WZ6)

(-) Gene Ontology  (51, 51)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ATP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4wz6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4wz6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CFTR_HUMAN | P13569
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.6.3.49
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CFTR_HUMAN | P13569
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CFTR_HUMAN | P13569: 1nbd 1xmi 1xmj 2bbo 2bbs 2bbt 2lob 2pze 2pzf 2pzg 3gd7 3isw 5d2d 5d3e 5d3f 5uak

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4WZ6)