1XMI - JenaLib

Asymmetric Unit (55, 273)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_000160	A	455	E	CFTR_HUMAN	Disease (CF)	74551128	A/B/C/D/E	A	455	E
02	UniProt	VAR_000161	V	456	F	CFTR_HUMAN	Disease (CF)	397508195	A/B/C/D/E	V	456	F
03	UniProt	VAR_000162	G	458	V	CFTR_HUMAN	Disease (CF)	121909009	A/B/C/D/E	G	458	V
04	UniProt	VAR_000163	L	467	F	CFTR_HUMAN	Polymorphism	1800089	A/B/C/D/E	L	467	F
05	UniProt	VAR_000164	V	470	M	CFTR_HUMAN	Polymorphism	213950	A/B/C/D/E	M	470	M
06	UniProt	VAR_000165	G	480	C	CFTR_HUMAN	Disease (CF)	79282516	A/B/C/D/E	G	480	C
07	UniProt	VAR_000166	S	492	F	CFTR_HUMAN	Disease (CF)	121909017	A/B/C/D/E	S	492	F
08	UniProt	VAR_000167	E	504	Q	CFTR_HUMAN	Disease (CF)	397508223	A/B/C/D/E	E	504	Q
09	UniProt	VAR_009901	I	506	M	CFTR_HUMAN	Polymorphism	1800092	A/B/C/D/E	I	506	M
10	UniProt	VAR_000168	I	506	V	CFTR_HUMAN	Polymorphism	1800091	A/B/C/D/E	I	506	V
11	UniProt	VAR_000169	I	507	V	CFTR_HUMAN	Polymorphism	1800091	A/B/C/D/E	I	507	V
12	UniProt	VAR_000172	F	508	C	CFTR_HUMAN	Polymorphism	1800093	A/B/C/D/E	A	508	C
13	UniProt	VAR_000173	D	513	G	CFTR_HUMAN	Disease (CBAVD)	397508225	A/B/C/D/E	D	513	G
14	UniProt	VAR_000174	V	520	F	CFTR_HUMAN	Disease (CF)	77646904	A/B/C/D/E	V	520	F
15	UniProt	VAR_048150	K	532	E	CFTR_HUMAN	Polymorphism	35032490	A/B/C/D/E	K	532	E
16	UniProt	VAR_000175	G	544	V	CFTR_HUMAN	Disease (CBAVD)	397508241	A/C/E	G	544	V
17	UniProt	VAR_000177	S	549	I	CFTR_HUMAN	Disease (CF)	121908755	A/B/C/D/E	S	549	I
18	UniProt	VAR_000176	S	549	N	CFTR_HUMAN	Disease (CF)	121908755	A/B/C/D/E	S	549	N
19	UniProt	VAR_000178	S	549	R	CFTR_HUMAN	Disease (CF)	121909005	A/B/C/D/E	S	549	R
20	UniProt	VAR_000179	G	551	D	CFTR_HUMAN	Disease (CF)	75527207	A/B/C/D/E	G	551	D
21	UniProt	VAR_000180	G	551	S	CFTR_HUMAN	Disease (CF)	121909013	A/B/C/D/E	G	551	S
22	UniProt	VAR_000181	R	553	Q	CFTR_HUMAN	Disease (CF)	121909044	A/B/C/D/E	R	553	Q
23	UniProt	VAR_000182	L	558	S	CFTR_HUMAN	Disease (CF)	193922504	A/B/C/D/E	L	558	S
24	UniProt	VAR_000183	A	559	T	CFTR_HUMAN	Disease (CF)	75549581	A/B/C/D/E	A	559	T
25	UniProt	VAR_000184	R	560	K	CFTR_HUMAN	Disease (CF)	80055610	A/B/C/D/E	R	560	K
26	UniProt	VAR_000185	R	560	S	CFTR_HUMAN	Disease (CF)	397508267	A/B/C/D/E	R	560	S
27	UniProt	VAR_000186	R	560	T	CFTR_HUMAN	Disease (CF)	80055610	A/B/C/D/E	R	560	T
28	UniProt	VAR_000187	V	562	I	CFTR_HUMAN	Polymorphism	1800097	A/B/C/D/E	V	562	I
29	UniProt	VAR_000188	V	562	L	CFTR_HUMAN	Disease (CF)	1800097	A/B/C/D/E	V	562	L
30	UniProt	VAR_000189	Y	563	N	CFTR_HUMAN	Disease (CF)	121909006	A/B/C/D/E	Y	563	N
31	UniProt	VAR_000190	Y	569	C	CFTR_HUMAN	Disease (CF)	397508277	A/B/C/D/E	Y	569	C
32	UniProt	VAR_000191	Y	569	D	CFTR_HUMAN	Disease (CF)	397508276	A/B/C/D/E	Y	569	D
33	UniProt	VAR_000192	Y	569	H	CFTR_HUMAN	Disease (CF)	397508276	A/B/C/D/E	Y	569	H
34	UniProt	VAR_000193	L	571	S	CFTR_HUMAN	Disease (CF)	397508280	A/B/C/D/E	L	571	S
35	UniProt	VAR_000194	D	572	N	CFTR_HUMAN	Disease (CF)	397508282	A/B/C/D/E	D	572	N
36	UniProt	VAR_000195	P	574	H	CFTR_HUMAN	Disease (CF)	121908758	A/B/C/D/E	P	574	H
37	UniProt	VAR_000196	G	576	A	CFTR_HUMAN	Polymorphism	1800098	A/B/C/D/E	G	576	A
38	UniProt	VAR_000197	D	579	G	CFTR_HUMAN	Disease (CF)	397508288	A/B/C/D/E	D	579	G
39	UniProt	VAR_000198	I	601	F	CFTR_HUMAN	Disease (CF)	397508306	A/B/C/D/E	I	601	F
40	UniProt	VAR_048151	S	605	F	CFTR_HUMAN	Polymorphism	766874	A/B/C/D/E	S	605	F
41	UniProt	VAR_000199	L	610	S	CFTR_HUMAN	Disease (CF)	397508311	A/B/C/D/E	L	610	S
42	UniProt	VAR_000200	A	613	T	CFTR_HUMAN	Disease (CF)	201978662	A/B/C/D/E	A	613	T
43	UniProt	VAR_000201	D	614	G	CFTR_HUMAN	Disease (CF)	201124247	A/B/C/D/E	D	614	G
44	UniProt	VAR_000202	I	618	T	CFTR_HUMAN	Disease (CF)	139468767	A/B/C/D/E	I	618	T
45	UniProt	VAR_000203	L	619	S	CFTR_HUMAN	Disease (CF)	397508313	A/B/C/D/E	L	619	S
46	UniProt	VAR_000204	H	620	P	CFTR_HUMAN	Disease (CF)	397508314	A/B/C/D/E	H	620	P
47	UniProt	VAR_000205	H	620	Q	CFTR_HUMAN	Disease (CF)	397508315	A/B/C/D/E	H	620	Q
48	UniProt	VAR_000206	G	622	D	CFTR_HUMAN	Polymorphism	121908759	A/B/C/D/E	G	622	D
49	UniProt	VAR_000207	G	628	R	CFTR_HUMAN	Disease (CF)	397508316	A/B/C/D/E	G	628	R
50	UniProt	VAR_000208	L	633	P	CFTR_HUMAN	Disease (CF)	397508318	A/B/C/D/E	L	633	P
51	UniProt	VAR_000209	D	648	V	CFTR_HUMAN	Disease (CF)	121909033	A/B/C/D/E	D	648	V
52	UniProt	VAR_000210	D	651	N	CFTR_HUMAN	Disease (CF)	780526529	A/B/C/D/E	D	651	N
53	UniProt	VAR_009902	S	654	G	CFTR_HUMAN	Polymorphism	1800099	A/B/C/D/E	S	654	G
54	UniProt	VAR_000211	T	665	S	CFTR_HUMAN	Disease (CF)	---	A/B/C/D/E	T	665	S
55	UniProt	VAR_000212	R	668	C	CFTR_HUMAN	Polymorphism	1800100	A/B/C/D/E	R	668	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (55, 273)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_000160	A	455	E	CFTR_HUMAN	Disease (CF)	74551128	A/B/C/D/E	A	455	E
02	UniProt	VAR_000161	V	456	F	CFTR_HUMAN	Disease (CF)	397508195	A/B/C/D/E	V	456	F
03	UniProt	VAR_000162	G	458	V	CFTR_HUMAN	Disease (CF)	121909009	A/B/C/D/E	G	458	V
04	UniProt	VAR_000163	L	467	F	CFTR_HUMAN	Polymorphism	1800089	A/B/C/D/E	L	467	F
05	UniProt	VAR_000164	V	470	M	CFTR_HUMAN	Polymorphism	213950	A/B/C/D/E	M	470	M
06	UniProt	VAR_000165	G	480	C	CFTR_HUMAN	Disease (CF)	79282516	A/B/C/D/E	G	480	C
07	UniProt	VAR_000166	S	492	F	CFTR_HUMAN	Disease (CF)	121909017	A/B/C/D/E	S	492	F
08	UniProt	VAR_000167	E	504	Q	CFTR_HUMAN	Disease (CF)	397508223	A/B/C/D/E	E	504	Q
09	UniProt	VAR_009901	I	506	M	CFTR_HUMAN	Polymorphism	1800092	A/B/C/D/E	I	506	M
10	UniProt	VAR_000168	I	506	V	CFTR_HUMAN	Polymorphism	1800091	A/B/C/D/E	I	506	V
11	UniProt	VAR_000169	I	507	V	CFTR_HUMAN	Polymorphism	1800091	A/B/C/D/E	I	507	V
12	UniProt	VAR_000172	F	508	C	CFTR_HUMAN	Polymorphism	1800093	A/B/C/D/E	A	508	C
13	UniProt	VAR_000173	D	513	G	CFTR_HUMAN	Disease (CBAVD)	397508225	A/B/C/D/E	D	513	G
14	UniProt	VAR_000174	V	520	F	CFTR_HUMAN	Disease (CF)	77646904	A/B/C/D/E	V	520	F
15	UniProt	VAR_048150	K	532	E	CFTR_HUMAN	Polymorphism	35032490	A/B/C/D/E	K	532	E
16	UniProt	VAR_000175	G	544	V	CFTR_HUMAN	Disease (CBAVD)	397508241	A/C/E	G	544	V
17	UniProt	VAR_000177	S	549	I	CFTR_HUMAN	Disease (CF)	121908755	A/B/C/D/E	S	549	I
18	UniProt	VAR_000176	S	549	N	CFTR_HUMAN	Disease (CF)	121908755	A/B/C/D/E	S	549	N
19	UniProt	VAR_000178	S	549	R	CFTR_HUMAN	Disease (CF)	121909005	A/B/C/D/E	S	549	R
20	UniProt	VAR_000179	G	551	D	CFTR_HUMAN	Disease (CF)	75527207	A/B/C/D/E	G	551	D
21	UniProt	VAR_000180	G	551	S	CFTR_HUMAN	Disease (CF)	121909013	A/B/C/D/E	G	551	S
22	UniProt	VAR_000181	R	553	Q	CFTR_HUMAN	Disease (CF)	121909044	A/B/C/D/E	R	553	Q
23	UniProt	VAR_000182	L	558	S	CFTR_HUMAN	Disease (CF)	193922504	A/B/C/D/E	L	558	S
24	UniProt	VAR_000183	A	559	T	CFTR_HUMAN	Disease (CF)	75549581	A/B/C/D/E	A	559	T
25	UniProt	VAR_000184	R	560	K	CFTR_HUMAN	Disease (CF)	80055610	A/B/C/D/E	R	560	K
26	UniProt	VAR_000185	R	560	S	CFTR_HUMAN	Disease (CF)	397508267	A/B/C/D/E	R	560	S
27	UniProt	VAR_000186	R	560	T	CFTR_HUMAN	Disease (CF)	80055610	A/B/C/D/E	R	560	T
28	UniProt	VAR_000187	V	562	I	CFTR_HUMAN	Polymorphism	1800097	A/B/C/D/E	V	562	I
29	UniProt	VAR_000188	V	562	L	CFTR_HUMAN	Disease (CF)	1800097	A/B/C/D/E	V	562	L
30	UniProt	VAR_000189	Y	563	N	CFTR_HUMAN	Disease (CF)	121909006	A/B/C/D/E	Y	563	N
31	UniProt	VAR_000190	Y	569	C	CFTR_HUMAN	Disease (CF)	397508277	A/B/C/D/E	Y	569	C
32	UniProt	VAR_000191	Y	569	D	CFTR_HUMAN	Disease (CF)	397508276	A/B/C/D/E	Y	569	D
33	UniProt	VAR_000192	Y	569	H	CFTR_HUMAN	Disease (CF)	397508276	A/B/C/D/E	Y	569	H
34	UniProt	VAR_000193	L	571	S	CFTR_HUMAN	Disease (CF)	397508280	A/B/C/D/E	L	571	S
35	UniProt	VAR_000194	D	572	N	CFTR_HUMAN	Disease (CF)	397508282	A/B/C/D/E	D	572	N
36	UniProt	VAR_000195	P	574	H	CFTR_HUMAN	Disease (CF)	121908758	A/B/C/D/E	P	574	H
37	UniProt	VAR_000196	G	576	A	CFTR_HUMAN	Polymorphism	1800098	A/B/C/D/E	G	576	A
38	UniProt	VAR_000197	D	579	G	CFTR_HUMAN	Disease (CF)	397508288	A/B/C/D/E	D	579	G
39	UniProt	VAR_000198	I	601	F	CFTR_HUMAN	Disease (CF)	397508306	A/B/C/D/E	I	601	F
40	UniProt	VAR_048151	S	605	F	CFTR_HUMAN	Polymorphism	766874	A/B/C/D/E	S	605	F
41	UniProt	VAR_000199	L	610	S	CFTR_HUMAN	Disease (CF)	397508311	A/B/C/D/E	L	610	S
42	UniProt	VAR_000200	A	613	T	CFTR_HUMAN	Disease (CF)	201978662	A/B/C/D/E	A	613	T
43	UniProt	VAR_000201	D	614	G	CFTR_HUMAN	Disease (CF)	201124247	A/B/C/D/E	D	614	G
44	UniProt	VAR_000202	I	618	T	CFTR_HUMAN	Disease (CF)	139468767	A/B/C/D/E	I	618	T
45	UniProt	VAR_000203	L	619	S	CFTR_HUMAN	Disease (CF)	397508313	A/B/C/D/E	L	619	S
46	UniProt	VAR_000204	H	620	P	CFTR_HUMAN	Disease (CF)	397508314	A/B/C/D/E	H	620	P
47	UniProt	VAR_000205	H	620	Q	CFTR_HUMAN	Disease (CF)	397508315	A/B/C/D/E	H	620	Q
48	UniProt	VAR_000206	G	622	D	CFTR_HUMAN	Polymorphism	121908759	A/B/C/D/E	G	622	D
49	UniProt	VAR_000207	G	628	R	CFTR_HUMAN	Disease (CF)	397508316	A/B/C/D/E	G	628	R
50	UniProt	VAR_000208	L	633	P	CFTR_HUMAN	Disease (CF)	397508318	A/B/C/D/E	L	633	P
51	UniProt	VAR_000209	D	648	V	CFTR_HUMAN	Disease (CF)	121909033	A/B/C/D/E	D	648	V
52	UniProt	VAR_000210	D	651	N	CFTR_HUMAN	Disease (CF)	780526529	A/B/C/D/E	D	651	N
53	UniProt	VAR_009902	S	654	G	CFTR_HUMAN	Polymorphism	1800099	A/B/C/D/E	S	654	G
54	UniProt	VAR_000211	T	665	S	CFTR_HUMAN	Disease (CF)	---	A/B/C/D/E	T	665	S
55	UniProt	VAR_000212	R	668	C	CFTR_HUMAN	Polymorphism	1800100	A/B/C/D/E	R	668	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (55, 546)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_000160	A	455	E	CFTR_HUMAN	Disease (CF)	74551128	A/B/C/D/E	A	455	E
02	UniProt	VAR_000161	V	456	F	CFTR_HUMAN	Disease (CF)	397508195	A/B/C/D/E	V	456	F
03	UniProt	VAR_000162	G	458	V	CFTR_HUMAN	Disease (CF)	121909009	A/B/C/D/E	G	458	V
04	UniProt	VAR_000163	L	467	F	CFTR_HUMAN	Polymorphism	1800089	A/B/C/D/E	L	467	F
05	UniProt	VAR_000164	V	470	M	CFTR_HUMAN	Polymorphism	213950	A/B/C/D/E	M	470	M
06	UniProt	VAR_000165	G	480	C	CFTR_HUMAN	Disease (CF)	79282516	A/B/C/D/E	G	480	C
07	UniProt	VAR_000166	S	492	F	CFTR_HUMAN	Disease (CF)	121909017	A/B/C/D/E	S	492	F
08	UniProt	VAR_000167	E	504	Q	CFTR_HUMAN	Disease (CF)	397508223	A/B/C/D/E	E	504	Q
09	UniProt	VAR_009901	I	506	M	CFTR_HUMAN	Polymorphism	1800092	A/B/C/D/E	I	506	M
10	UniProt	VAR_000168	I	506	V	CFTR_HUMAN	Polymorphism	1800091	A/B/C/D/E	I	506	V
11	UniProt	VAR_000169	I	507	V	CFTR_HUMAN	Polymorphism	1800091	A/B/C/D/E	I	507	V
12	UniProt	VAR_000172	F	508	C	CFTR_HUMAN	Polymorphism	1800093	A/B/C/D/E	A	508	C
13	UniProt	VAR_000173	D	513	G	CFTR_HUMAN	Disease (CBAVD)	397508225	A/B/C/D/E	D	513	G
14	UniProt	VAR_000174	V	520	F	CFTR_HUMAN	Disease (CF)	77646904	A/B/C/D/E	V	520	F
15	UniProt	VAR_048150	K	532	E	CFTR_HUMAN	Polymorphism	35032490	A/B/C/D/E	K	532	E
16	UniProt	VAR_000175	G	544	V	CFTR_HUMAN	Disease (CBAVD)	397508241	A/C/E	G	544	V
17	UniProt	VAR_000177	S	549	I	CFTR_HUMAN	Disease (CF)	121908755	A/B/C/D/E	S	549	I
18	UniProt	VAR_000176	S	549	N	CFTR_HUMAN	Disease (CF)	121908755	A/B/C/D/E	S	549	N
19	UniProt	VAR_000178	S	549	R	CFTR_HUMAN	Disease (CF)	121909005	A/B/C/D/E	S	549	R
20	UniProt	VAR_000179	G	551	D	CFTR_HUMAN	Disease (CF)	75527207	A/B/C/D/E	G	551	D
21	UniProt	VAR_000180	G	551	S	CFTR_HUMAN	Disease (CF)	121909013	A/B/C/D/E	G	551	S
22	UniProt	VAR_000181	R	553	Q	CFTR_HUMAN	Disease (CF)	121909044	A/B/C/D/E	R	553	Q
23	UniProt	VAR_000182	L	558	S	CFTR_HUMAN	Disease (CF)	193922504	A/B/C/D/E	L	558	S
24	UniProt	VAR_000183	A	559	T	CFTR_HUMAN	Disease (CF)	75549581	A/B/C/D/E	A	559	T
25	UniProt	VAR_000184	R	560	K	CFTR_HUMAN	Disease (CF)	80055610	A/B/C/D/E	R	560	K
26	UniProt	VAR_000185	R	560	S	CFTR_HUMAN	Disease (CF)	397508267	A/B/C/D/E	R	560	S
27	UniProt	VAR_000186	R	560	T	CFTR_HUMAN	Disease (CF)	80055610	A/B/C/D/E	R	560	T
28	UniProt	VAR_000187	V	562	I	CFTR_HUMAN	Polymorphism	1800097	A/B/C/D/E	V	562	I
29	UniProt	VAR_000188	V	562	L	CFTR_HUMAN	Disease (CF)	1800097	A/B/C/D/E	V	562	L
30	UniProt	VAR_000189	Y	563	N	CFTR_HUMAN	Disease (CF)	121909006	A/B/C/D/E	Y	563	N
31	UniProt	VAR_000190	Y	569	C	CFTR_HUMAN	Disease (CF)	397508277	A/B/C/D/E	Y	569	C
32	UniProt	VAR_000191	Y	569	D	CFTR_HUMAN	Disease (CF)	397508276	A/B/C/D/E	Y	569	D
33	UniProt	VAR_000192	Y	569	H	CFTR_HUMAN	Disease (CF)	397508276	A/B/C/D/E	Y	569	H
34	UniProt	VAR_000193	L	571	S	CFTR_HUMAN	Disease (CF)	397508280	A/B/C/D/E	L	571	S
35	UniProt	VAR_000194	D	572	N	CFTR_HUMAN	Disease (CF)	397508282	A/B/C/D/E	D	572	N
36	UniProt	VAR_000195	P	574	H	CFTR_HUMAN	Disease (CF)	121908758	A/B/C/D/E	P	574	H
37	UniProt	VAR_000196	G	576	A	CFTR_HUMAN	Polymorphism	1800098	A/B/C/D/E	G	576	A
38	UniProt	VAR_000197	D	579	G	CFTR_HUMAN	Disease (CF)	397508288	A/B/C/D/E	D	579	G
39	UniProt	VAR_000198	I	601	F	CFTR_HUMAN	Disease (CF)	397508306	A/B/C/D/E	I	601	F
40	UniProt	VAR_048151	S	605	F	CFTR_HUMAN	Polymorphism	766874	A/B/C/D/E	S	605	F
41	UniProt	VAR_000199	L	610	S	CFTR_HUMAN	Disease (CF)	397508311	A/B/C/D/E	L	610	S
42	UniProt	VAR_000200	A	613	T	CFTR_HUMAN	Disease (CF)	201978662	A/B/C/D/E	A	613	T
43	UniProt	VAR_000201	D	614	G	CFTR_HUMAN	Disease (CF)	201124247	A/B/C/D/E	D	614	G
44	UniProt	VAR_000202	I	618	T	CFTR_HUMAN	Disease (CF)	139468767	A/B/C/D/E	I	618	T
45	UniProt	VAR_000203	L	619	S	CFTR_HUMAN	Disease (CF)	397508313	A/B/C/D/E	L	619	S
46	UniProt	VAR_000204	H	620	P	CFTR_HUMAN	Disease (CF)	397508314	A/B/C/D/E	H	620	P
47	UniProt	VAR_000205	H	620	Q	CFTR_HUMAN	Disease (CF)	397508315	A/B/C/D/E	H	620	Q
48	UniProt	VAR_000206	G	622	D	CFTR_HUMAN	Polymorphism	121908759	A/B/C/D/E	G	622	D
49	UniProt	VAR_000207	G	628	R	CFTR_HUMAN	Disease (CF)	397508316	A/B/C/D/E	G	628	R
50	UniProt	VAR_000208	L	633	P	CFTR_HUMAN	Disease (CF)	397508318	A/B/C/D/E	L	633	P
51	UniProt	VAR_000209	D	648	V	CFTR_HUMAN	Disease (CF)	121909033	A/B/C/D/E	D	648	V
52	UniProt	VAR_000210	D	651	N	CFTR_HUMAN	Disease (CF)	780526529	A/B/C/D/E	D	651	N
53	UniProt	VAR_009902	S	654	G	CFTR_HUMAN	Polymorphism	1800099	A/B/C/D/E	S	654	G
54	UniProt	VAR_000211	T	665	S	CFTR_HUMAN	Disease (CF)	---	A/B/C/D/E	T	665	S
55	UniProt	VAR_000212	R	668	C	CFTR_HUMAN	Polymorphism	1800100	A/B/C/D/E	R	668	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 5)

Exons (6, 30)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:267
 aligned with CFTR_HUMAN | P13569 from UniProtKB/Swiss-Prot  Length:1480

    Alignment length:284
                                   397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667    
           CFTR_HUMAN   388 TTTEVVMENVTAFWEEGFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLHRFSL 671
               SCOP domains d1xmia_ A: Cystic fibros                 is transmembrane conductance regulator, CFTR, nucleotide-binding domain                                                                                                                                                                             SCOP domains
               CATH domains 1xmiA00 A:388-671 P-loop                  containing nucleotide triphosphate hydrolases                                                                                                                                                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeee..hhhhhhhhh.-----------------...hhhhhh...eeeeeeee....eeeee.....hhhhhhhhhh....eeeeeee....eeee........eehhhhhhh....hhhhhhhhhhhh.hhhhhhh..hhhh.ee.......hhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhh........eeeee..hhhhhhhh.eeeeee..eeeeeehhhhhhhhh.hhhhhh.........hhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -------------------------------------------------------------------EF-V--------F--M---------C-----------F-----------Q-MVC----G------F-----------E-----------V----I-D-Q----STK-IN-----C-SN-H-A--G---------------------F---F----S--TG---TSP-D-----R----P--------------V--N--G----------S--C--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------------------V------------------------------------------N-S--------S-L------D--------------------------------------------------Q--------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------------------------------------------------------------------------------------------------------------------------------------------------------------R----------T--------H------------------------------------------------------------------------------------------------------ SAPs(SNPs) (3)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------ABC_TRANSPORTER------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.11       Exon 1.12  PDB: A:404-464 (gaps) UniProt: 404-464            Exon 1.13a  PDB: A:465-528 UniProt: 465-528                     Exon 1.15b  PDB: A:529-560      ----------------------------Exon 1.17  PDB: A:589-671 UniProt: 589-830 [INCOMPLETE]                             Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.16  PDB: A:560-589     ---------------------------------------------------------------------------------- Transcript 1 (2)
                 1xmi A 388 STTEVVMENVTAFWEEGFGELFEK-----------------SFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLRRFSL 671
                                   397       407   |     -         - |     437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667    
                                                 411               429

Chain B from PDB  Type:PROTEIN  Length:258
 aligned with CFTR_HUMAN | P13569 from UniProtKB/Swiss-Prot  Length:1480

    Alignment length:284
                                   397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667    
           CFTR_HUMAN   388 TTTEVVMENVTAFWEEGFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLHRFSL 671
               SCOP domains d1xmib_ B: Cystic fibrosis                transmembrane conductance regulator, CFTR, nucleotide-binding domain                                                                                                                                                                               SCOP domains
               CATH domains 1xmiB00 B:388-671 P-loop c               ontaining nucleotide triphosphate hydrolases                                                                                                                                                                                                        CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeee..hhhhhhhhhhhh---------------...hhhhhh...eeeeeeee....eeeee.....hhhhhhhhhh....eeeeeee....eeee.........hhhhhhhh....hhhhhhhhhhhh.hhhhhhh------...-----..hhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhh........eeeee..hhhhhhhh.eeeeee..eeeeeehhhhhhhhh...hhhhhh..hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -------------------------------------------------------------------EF-V--------F--M---------C-----------F-----------Q-MVC----G------F-----------E----------------I-D-Q----STK-IN-----C-SN-H-A--G---------------------F---F----S--TG---TSP-D-----R----P--------------V--N--G----------S--C--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------------------V------------------------------------------N-S--------S-L------D--------------------------------------------------Q--------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------------------------------------------------------------------------------------------------------------------------------------------------------------R----------T--------H------------------------------------------------------------------------------------------------------ SAPs(SNPs) (3)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------ABC_TRANSPORTER------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.11       Exon 1.12  PDB: B:404-464 (gaps) UniProt: 404-464            Exon 1.13a  PDB: B:465-528 UniProt: 465-528                     Exon 1.15b  PDB: B:529-560 (gaps----------------------------Exon 1.17  PDB: B:589-671 UniProt: 589-830 [INCOMPLETE]                             Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.16  PDB: B:560-589     ---------------------------------------------------------------------------------- Transcript 1 (2)
                 1xmi B 388 STTEVVMENVTAFWEEGFGELFEKAK---------------SFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIAGVSYDEYRYRSVIKACQLEEDISK------IVL-----TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLRRFSL 671
                                   397       407     |   -         - |     437       447       457       467       477       487       497       507       517       527    |    - | |   547       557       567       577       587       597       607       617       627       637       647       657       667    
                                                   413             429                                                                                                    532    539 |   547                                                                                                                            
                                                                                                                                                                                   541

Chain C from PDB  Type:PROTEIN  Length:270
 aligned with CFTR_HUMAN | P13569 from UniProtKB/Swiss-Prot  Length:1480

    Alignment length:283
                                   398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668   
           CFTR_HUMAN   389 TTEVVMENVTAFWEEGFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLHRFSL 671
               SCOP domains d1xmic_ C: Cystic fibrosis              transmembrane conductance regulator, CFTR, nucleotide-binding domain                                                                                                                                                                                SCOP domains
               CATH domains 1xmiC00 C:389-671 P-loop co             ntaining nucleotide triphosphate hydrolases                                                                                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee..hhhhhhhhhhhhhh-------------...hhhhhh...eeeeeeee....eeeeee....hhhhhhhhhh....eeeeeee....eeee........eehhhhhhh....hhhhhhhhhhhh.hhhhhhhh.hhhh.ee.......hhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhh........eeeee..hhhhhhhh.eeeeee..eeeeeehhhhhhhhh...hhhhhh..hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ------------------------------------------------------------------EF-V--------F--M---------C-----------F-----------Q-MVC----G------F-----------E-----------V----I-D-Q----STK-IN-----C-SN-H-A--G---------------------F---F----S--TG---TSP-D-----R----P--------------V--N--G----------S--C--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------V------------------------------------------N-S--------S-L------D--------------------------------------------------Q--------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------R----------T--------H------------------------------------------------------------------------------------------------------ SAPs(SNPs) (3)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------ABC_TRANSPORTER------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.11      Exon 1.12  PDB: C:404-464 (gaps) UniProt: 404-464            Exon 1.13a  PDB: C:465-528 UniProt: 465-528                     Exon 1.15b  PDB: C:529-560      ----------------------------Exon 1.17  PDB: C:589-671 UniProt: 589-830 [INCOMPLETE]                             Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.16  PDB: C:560-589     ---------------------------------------------------------------------------------- Transcript 1 (2)
                 1xmi C 389 TTEVVMENVTAFWEEGFGELFEKAKQN-------------SFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLRRFSL 671
                                   398       408      |  -         -|      438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668   
                                                    415           429

Chain D from PDB  Type:PROTEIN  Length:268
 aligned with CFTR_HUMAN | P13569 from UniProtKB/Swiss-Prot  Length:1480

    Alignment length:285
                                   397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667     
           CFTR_HUMAN   388 TTTEVVMENVTAFWEEGFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLHRFSLE 672
               SCOP domains d1xmid_ D: Cystic fibro               sis transmembrane conductance regulator, CFTR, nucleotide-binding domain                                                                                                                                                                                SCOP domains
               CATH domains 1xmiD00 D:388-672 P-loo               p containing nucleotide triphosphate hydrolases                                                                                                                                                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeee...........---------------......hhhhhh...eeeeeeee....eeeee.....hhhhhhhhhh....eeeeeee....eeee........eehhhhhhh....hhhhhhhhhhhh.hhhhhhhh.hhhh.ee..--...hhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhh........eeeee..hhhhhhhh.eeeeee..eeeeeehhhhhhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) -------------------------------------------------------------------EF-V--------F--M---------C-----------F-----------Q-MVC----G------F-----------E----------------I-D-Q----STK-IN-----C-SN-H-A--G---------------------F---F----S--TG---TSP-D-----R----P--------------V--N--G----------S--C---- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------------------V------------------------------------------N-S--------S-L------D--------------------------------------------------Q---------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------------------------------------------------------------------------------------------------------------------------------------------------------------R----------T--------H------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------ABC_TRANSPORTER-------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.11       Exon 1.12  PDB: D:404-464 (gaps) UniProt: 404-464            Exon 1.13a  PDB: D:465-528 UniProt: 465-528                     Exon 1.15b  PDB: D:529-560 (gaps----------------------------Exon 1.17  PDB: D:589-672 UniProt: 589-830 [INCOMPLETE]                              Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.16  PDB: D:560-589     ----------------------------------------------------------------------------------- Transcript 1 (2)
                 1xmi D 388 STTEVVMENVTAFWEEGFGELFE---------------DSLSFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGE--ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLRRFSLE 672
                                   397       407  |      -       427       437       447       457       467       477       487       497       507       517       527       537     | 547       557       567       577       587       597       607       617       627       637       647       657       667     
                                                410             426                                                                                                                  543  |                                                                                                                              
                                                                                                                                                                                        546

Chain E from PDB  Type:PROTEIN  Length:266
 aligned with CFTR_HUMAN | P13569 from UniProtKB/Swiss-Prot  Length:1480

    Alignment length:283
                                   398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668   
           CFTR_HUMAN   389 TTEVVMENVTAFWEEGFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLHRFSL 671
               SCOP domains d1xmie_ E: Cystic fibro                 sis transmembrane conductance regulator, CFTR, nucleotide-binding domain                                                                                                                                                                            SCOP domains
               CATH domains 1xmiE00 E:389-671 P-loo                 p containing nucleotide triphosphate hydrolases                                                                                                                                                                                                     CATH domains
           Pfam domains (1) ----------------------------------------------------------------------------ABC_tran-1xmiE01 E:465-576                                                                                      --------------------------------------------------------------CFTR_R-1xmiE06 E:639-671          Pfam domains (1)
           Pfam domains (2) ----------------------------------------------------------------------------ABC_tran-1xmiE02 E:465-576                                                                                      --------------------------------------------------------------CFTR_R-1xmiE07 E:639-671          Pfam domains (2)
           Pfam domains (3) ----------------------------------------------------------------------------ABC_tran-1xmiE03 E:465-576                                                                                      --------------------------------------------------------------CFTR_R-1xmiE08 E:639-671          Pfam domains (3)
           Pfam domains (4) ----------------------------------------------------------------------------ABC_tran-1xmiE04 E:465-576                                                                                      --------------------------------------------------------------CFTR_R-1xmiE09 E:639-671          Pfam domains (4)
           Pfam domains (5) ----------------------------------------------------------------------------ABC_tran-1xmiE05 E:465-576                                                                                      --------------------------------------------------------------CFTR_R-1xmiE10 E:639-671          Pfam domains (5)
         Sec.struct. author ...eeeeeeee...hhhhhhhh.-----------------...hhhhhh...eeeeeeee....eeeee.....hhhhhhhhhh....eeeeeee....eeee........eehhhhhhh....hhhhhhhhhhhh.hhhhhhhh.hhhh.ee.......hhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhh........eeeee..hhhhhhhh.eeeeee..eeeeeehhhhhhhhh...hhhhhh..hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ------------------------------------------------------------------EF-V--------F--M---------C-----------F-----------Q-MVC----G------F-----------E-----------V----I-D-Q----STK-IN-----C-SN-H-A--G---------------------F---F----S--TG---TSP-D-----R----P--------------V--N--G----------S--C--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------V------------------------------------------N-S--------S-L------D--------------------------------------------------Q--------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------R----------T--------H------------------------------------------------------------------------------------------------------ SAPs(SNPs) (3)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------ABC_TRANSPORTER------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.11      Exon 1.12  PDB: E:404-464 (gaps) UniProt: 404-464            Exon 1.13a  PDB: E:465-528 UniProt: 465-528                     Exon 1.15b  PDB: E:529-560      ----------------------------Exon 1.17  PDB: E:589-671 UniProt: 589-830 [INCOMPLETE]                             Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.16  PDB: E:560-589     ---------------------------------------------------------------------------------- Transcript 1 (2)
                 1xmi E 389 TTEVVMENVTAFWEEGFGELFEK-----------------SFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLRRFSL 671
                                   398       408  |      -         -|      438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668   
                                                411               429

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 5)

CATH Domains (1, 5)

Pfam Domains (2, 10)

Gene Ontology (51, 51)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E (CFTR_HUMAN | P13569)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016887	ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
	GO:0042626	ATPase activity, coupled to transmembrane movement of substances	Catalysis of the reaction: ATP + H2O = ADP + phosphate, to directly drive the active transport of a substance across a membrane.
	GO:0043225	ATPase-coupled anion transmembrane transporter activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: ATP + H2O + anion(out) = ADP + phosphate + anion(in).
	GO:0030165	PDZ domain binding	Interacting selectively and non-covalently with a PDZ domain of a protein, a domain found in diverse signaling proteins.
	GO:0015106	bicarbonate transmembrane transporter activity	Enables the transfer of bicarbonate from one side of a membrane to the other. Bicarbonate is the hydrogencarbonate ion, HCO3-.
	GO:0005254	chloride channel activity	Enables the facilitated diffusion of a chloride (by an energy-independent process) involving passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
	GO:0019869	chloride channel inhibitor activity	Stops, prevents, or reduces the activity of a chloride channel.
	GO:0017081	chloride channel regulator activity	Modulates the activity of a chloride channel.
	GO:0015108	chloride transmembrane transporter activity	Enables the transfer of chloride ions from one side of a membrane to the other.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0005260	intracellular ATPase-gated chloride channel activity	Enables passage of a chloride ion through a transmembrane channel that opens when intracellular ATP is bound and hydrolysed. Passage is via passive diffusion once the channel is open.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0015701	bicarbonate transport	The directed movement of bicarbonate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0071320	cellular response to cAMP	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
	GO:1902476	chloride transmembrane transport	The directed movement of chloride across a membrane.
	GO:0006821	chloride transport	The directed movement of chloride into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006695	cholesterol biosynthetic process	The chemical reactions and pathways resulting in the formation of cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones.
	GO:0030301	cholesterol transport	The directed movement of cholesterol, cholest-5-en-3-beta-ol, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0051454	intracellular pH elevation	Any process that increases the internal pH of a cell, measured by the concentration of the hydrogen ion.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0060081	membrane hyperpolarization	The process in which membrane potential increases with respect to its steady-state potential, usually from negative potential to a more negative potential. For example, during the repolarization phase of an action potential the membrane potential often becomes more negative or hyperpolarized before returning to the steady-state resting potential.
	GO:1902161	positive regulation of cyclic nucleotide-gated ion channel activity	Any process that activates or increases the frequency, rate or extent of cyclic nucleotide-gated ion channel activity.
	GO:0045921	positive regulation of exocytosis	Any process that activates or increases the frequency, rate or extent of exocytosis.
	GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	Any process that increases the frequency, rate or extent of the regulated release of insulin that contributes to the response of a cell to glucose.
	GO:1902943	positive regulation of voltage-gated chloride channel activity	Any process that activates or increases the frequency, rate or extent of voltage-gated chloride channel activity.
	GO:0007585	respiratory gaseous exchange	The process of gaseous exchange between an organism and its environment. In plants, microorganisms, and many small animals, air or water makes direct contact with the organism's cells or tissue fluids, and the processes of diffusion supply the organism with dioxygen (O2) and remove carbon dioxide (CO2). In larger animals the efficiency of gaseous exchange is improved by specialized respiratory organs, such as lungs and gills, which are ventilated by breathing mechanisms.
	GO:0048240	sperm capacitation	A process required for sperm to reach fertilization competence. Sperm undergo an incompletely understood series of morphological and molecular maturational processes, termed capacitation, involving, among other processes, protein tyrosine phosphorylation and increased intracellular calcium.
	GO:0055085	transmembrane transport	The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0006904	vesicle docking involved in exocytosis	The initial attachment of a vesicle membrane to a target membrane, mediated by proteins protruding from the membrane of the vesicle and the target membrane, that contributes to exocytosis.
cellular component
	GO:0030660	Golgi-associated vesicle membrane	The lipid bilayer surrounding a vesicle associated with the Golgi apparatus.
	GO:0016324	apical plasma membrane	The region of the plasma membrane located at the apical end of the cell.
	GO:0016323	basolateral plasma membrane	The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0034707	chloride channel complex	An ion channel complex through which chloride ions pass.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005769	early endosome	A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
	GO:0031901	early endosome membrane	The lipid bilayer surrounding an early endosome.
	GO:0031205	endoplasmic reticulum Sec complex	An endoplasmic reticulum membrane-associated complex involved in the translocation of proteins that are targeted to the ER. In yeast, this complex consists of two subcomplexes, namely, the Sec61 complex and the Sec62/Sec63 complex.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005765	lysosomal membrane	The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0055037	recycling endosome	An organelle consisting of a network of tubules that functions in targeting molecules, such as receptors transporters and lipids, to the plasma membrane.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 10)

Sites (10, 10)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (55, 273)

PROSITE Motifs (1, 5)

Exons (6, 30)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 5)

CATH Domains (1, 5)

Pfam Domains (2, 10)

Gene Ontology (51, 51)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File