|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2KAI) |
(no "Site" information available for 2KAI) |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
(no "SAP(SNP)/Variant" information available for 2KAI) |
Asymmetric/Biological Unit (5, 5)
|
(no "Exon" information available for 2KAI) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:80 aligned with KLK_PIG | P00752 from UniProtKB/Swiss-Prot Length:246 Alignment length:80 17 27 37 47 57 67 77 87 KLK_PIG 8 IIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGRHNLFENENTAQFFGVTADFPHPGFNLS 87 SCOP domains d2kai.1 A:,B: Kallikrein A SCOP domains CATH domains 2kaiA00 A:16-95B Trypsin-like serine proteases CATH domains Pfam domains -------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) TRYPSIN_DOM PDB: A:16-95B UniProt: 8-243 PROSITE (1) PROSITE (2) -------------------------------------------------------------------------------- PROSITE (2) PROSITE (3) ------------------------------------TRYPSI-------------------------------------- PROSITE (3) Transcript -------------------------------------------------------------------------------- Transcript 2kai A 16 IIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGRHNLFENENTAQFFGVTADFPHPGFNLS 95B 25 35|| 46 56 66|| 77 87 95B 36| 67| 95A| 38 69 95B Chain B from PDB Type:PROTEIN Length:152 aligned with KLK_PIG | P00752 from UniProtKB/Swiss-Prot Length:246 Alignment length:152 104 114 124 134 144 154 164 174 184 194 204 214 224 234 244 KLK_PIG 95 ADGKDYSHDLMLLRLQSPAKITDAVKVLELPTQEPELGSTCEASGWGSIEPGPDBFEFPDEIQCVQLTLLQNTFCABAHPBKVTESMLCAGYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWINDTITENP 246 SCOP domains d2kai.1 A:,B: Kallikrein A SCOP domains CATH domains 2kaiB00 B:95Y-246 Trypsin-like serine proteases CATH domains Pfam domains (1) Trypsin-2kaiB01 B:95Y-238 -------- Pfam domains (1) Pfam domains (2) Trypsin-2kaiB02 B:95Y-238 -------- Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) TRYPSIN_DOM PDB: - UniProt: 8-243 --- PROSITE (1) PROSITE (2) -------------------------------------------------------------------------------------------------TRYPSIN_SER ------------------------------------------- PROSITE (2) PROSITE (3) -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3) Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2kai B 95Y ADGKDYSHDLMLLRLQSPAKITDAVKVLELPTQEPELGSTCEASGWGSIEPGPDDFEFPDEIQCVQLTLLQNTFCADAHPDKVTESMLCAGYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWIDDTITENP 246 || 103 113 123 || ||135 145 | | 153 163 173 183| | 191 201 || 215 | 224 234 244 || 125| || 147A | 184A 188A 203| 221A 95Y| 127 || 148A 208 95Z 130| 132 Chain I from PDB Type:PROTEIN Length:57 aligned with BPT1_BOVIN | P00974 from UniProtKB/Swiss-Prot Length:100 Alignment length:57 46 56 66 76 86 BPT1_BOVIN 37 PDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGA 93 SCOP domains d2kaii_ I: Pancreatic trypsin inhibitor, BPTI SCOP domains CATH domains 2kaiI00 I:2-58 Factor Xa Inhibitor CATH domains Pfam domains --Kunitz_BPTI-2kaiI01 I:4-56 -- Pfam domains SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs) PROSITE (2) ---BPTI_KUNITZ_2 PDB: I:5-55 UniProt: 40-90 --- PROSITE (2) PROSITE (3) -------------------------------BPTI_KUNITZ_1 ------- PROSITE (3) Transcript --------------------------------------------------------- Transcript 2kai I 2 PDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGA 58 11 21 31 41 51
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (KLK_PIG | P00752)
Chain I (BPT1_BOVIN | P00974)
|
|
|
|
|
|
|