1HIA - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   KALLIKREIN COMPLEXED WITH HIRUSTASIN

Authors :   P. Mittl, S. Di Marco, M. Gruetter

Date :   12 Dec 96 (Deposition) - 24 Dec 97 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym. Unit : A,B,I,J,X,Y
Biol. Unit 1: A,B,I  (1x)
Biol. Unit 2: J,X,Y  (1x)

Keywords :   Complex (Protease/Inhibitor), Tissue Kallikrein, Serine Protease, Trypsin, Psa, Kinin, Serpin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. R. Mittl, S. Di Marco, G. Fendrich, G. Pohlig, J. Heim, C. Sommerhoff, H. Fritz, J. P. Priestle, M. G. Grutter
A New Structural Class Of Serine Protease Inhibitors Revealed By The Structure Of The Hirustasin-Kallikrein Complex.
Structure V. 5 253 1997
PubMed-ID: 9032072 | Reference-DOI: 10.1016/S0969-2126(97)00183-4
(for further references see the PDB file header)

Molecule 1 - KALLIKREIN
	Chains	:	A, X
	EC Number	:	3.4.21.35
	Engineered	:	YES
	Organ	:	PANCREAS
	Organism Common	:	PIG
	Organism Scientific	:	SUS SCROFA
	Organism Taxid	:	9823

Molecule 2 - KALLIKREIN
	Chains	:	B, Y
	EC Number	:	3.4.21.35
	Engineered	:	YES
	Organ	:	PANCREAS
	Organism Common	:	PIG
	Organism Scientific	:	SUS SCROFA
	Organism Taxid	:	9823

Molecule 3 - HIRUSTASIN
	Chains	:	I, J
	Engineered	:	YES
	Organ	:	PANCREAS
	Organism Common	:	MEDICINAL LEECH
	Organism Scientific	:	HIRUDO MEDICINALIS
	Organism Taxid	:	6421

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	I	J	X	Y
Biological Unit 1 (1x)	:	A	B	I
Biological Unit 2 (1x)	:				J	X	Y

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1HIA)

(no "Site" information available for 1HIA)

Asymmetric Unit

No.	Residues
1	A:22	-	B:157
2	A:42	-	A:58
3	B:136	-	B:201
4	B:168	-	B:182
5	B:191	-	B:220
6	I:6	-	I:17
7	I:11	-	I:22
8	I:24	-	I:44
9	I:29	-	I:48
10	I:33	-	I:50
11	J:6	-	J:17
12	J:11	-	J:22
13	J:24	-	J:44
14	J:29	-	J:48
15	J:33	-	J:50
16	X:22	-	Y:157
17	X:42	-	X:58
18	Y:136	-	Y:201
19	Y:168	-	Y:182
20	Y:191	-	Y:220

Asymmetric Unit

No.	Residues
1	Gly B:147A	-	Pro B:147
2	Thr B:218	-	Pro B:219
3	Gly Y:147A	-	Pro Y:147
4	Thr Y:218	-	Pro Y:219

(no "SAP(SNP)/Variant" information available for 1HIA)

Asymmetric Unit (4, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRYPSIN_DOM	PS50240	Serine proteases, trypsin domain profile.	KLK_PIG	8-243	2	A:16-95B X:16-95B
2	ANTISTASIN	PS51252	Antistasin-like domain profile.	ANTA_HIRME	24-50	2	I:24-50 J:24-50
3	TRYPSIN_HIS	PS00134	Serine proteases, trypsin family, histidine active site.	KLK_PIG	44-49	2	A:53-58 X:53-58
4	TRYPSIN_SER	PS00135	Serine proteases, trypsin family, serine active site.	KLK_PIG	192-203	2	B:189-200 Y:189-200

Biological Unit 1 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRYPSIN_DOM	PS50240	Serine proteases, trypsin domain profile.	KLK_PIG	8-243	1	A:16-95B -
2	ANTISTASIN	PS51252	Antistasin-like domain profile.	ANTA_HIRME	24-50	1	I:24-50 -
3	TRYPSIN_HIS	PS00134	Serine proteases, trypsin family, histidine active site.	KLK_PIG	44-49	1	A:53-58 -
4	TRYPSIN_SER	PS00135	Serine proteases, trypsin family, serine active site.	KLK_PIG	192-203	1	B:189-200 -

Biological Unit 2 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRYPSIN_DOM	PS50240	Serine proteases, trypsin domain profile.	KLK_PIG	8-243	1	- X:16-95B
2	ANTISTASIN	PS51252	Antistasin-like domain profile.	ANTA_HIRME	24-50	1	- J:24-50
3	TRYPSIN_HIS	PS00134	Serine proteases, trypsin family, histidine active site.	KLK_PIG	44-49	1	- X:53-58
4	TRYPSIN_SER	PS00135	Serine proteases, trypsin family, serine active site.	KLK_PIG	192-203	1	- Y:189-200

(no "Exon" information available for 1HIA)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:80
 aligned with KLK_PIG | P00752 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:80
                                    17        27        37        47        57        67        77        87
             KLK_PIG      8 IIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGRHNLFENENTAQFFGVTADFPHPGFNLS   87
               SCOP domains d1hia.1 A:,B: Kallikrein A                                                       SCOP domains
               CATH domains 1hiaA00 A:16-95B Trypsin-like serine proteases                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee..eeeeeeeeee..eeee.hhh.....eeee............eeeeeeeeee....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: A:16-95B UniProt: 8-243                                        PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------TRYPSI-------------------------------------- PROSITE (3)
                 Transcript -------------------------------------------------------------------------------- Transcript
                1hia A   16 IIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGRHNLFENENTAQFFGVTADFPHPGFNLS  95B
                                    25        35||      46        56        66||      77        87       95B
                                               36|                           67|                        95A|
                                                38                            69                         95B

Chain B from PDB  Type:PROTEIN  Length:150
 aligned with KLK_PIG | P00752 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:150
                                   106       116       126       136       146       156       166       176       186       196       206       216       226       236       246
             KLK_PIG     97 GKDYSHDLMLLRLQSPAKITDAVKVLELPTQEPELGSTCEASGWGSIEPGPDBFEFPDEIQCVQLTLLQNTFCABAHPBKVTESMLCAGYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWINDTITENP  246
               SCOP domains d1hia.1 A:,B: Kallikrein A                                                                                                                             SCOP domains
               CATH domains 1hiaB00 B:96-246 Trypsin-like serine proteases                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ........eeeee........................eeeeee.................eeeeeeee.hhhhhhh........eeeee...............eeee..eeeeeeeeee.........eeeeehhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: - UniProt: 8-243                                                                                                                 --- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------TRYPSIN_SER ------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1hia B   96 GKDYSHDLMLLRLQSPAKITDAVKVLELPTQEPELGSTCEASGWGSIEPGPDDFEFPDEIQCVQLTLLQNTFCADAHPDKVTESMLCAGYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWIDDTITENP  246
                                   105       115       125|  ||  137      147A |     155       165       175       184   |   193       203|      217   |   226       236       246
                                                       125|  ||           147A |                                 184A 188A             203|         221A                          
                                                        127  ||             148A                                                        208                                       
                                                           130|                                                                                                                   
                                                            132

Chain I from PDB  Type:PROTEIN  Length:48
 aligned with ANTA_HIRME | P80302 from UniProtKB/Swiss-Prot  Length:55

    Alignment length:48
                                    14        24        34        44        
          ANTA_HIRME      5 TCGGETCSAAQVCLKGKCVCNEVHCRIRCKYGLKKDENGCEYPCSCAK   52
               SCOP domains d1hiai_ I: Hirustasin                            SCOP domains
               CATH domains 1hiaI00 I:5-52 Antistasin; domain 1              CATH domains
               Pfam domains ------------------------------------------------ Pfam domains
         Sec.struct. author .hhh......eee....eee..eee....................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------ SAPs(SNPs)
                PROSITE (2) -------------------ANTISTASIN  PDB: I:24-50   -- PROSITE (2)
                 Transcript ------------------------------------------------ Transcript
                1hia I    5 TCGGETCSAAQVCLKGKCVCNEVHCRIRCKYGLKKDENGCEYPCSCAK   52
                                    14        24        34        44

Chain J from PDB  Type:PROTEIN  Length:48
 aligned with ANTA_HIRME | P80302 from UniProtKB/Swiss-Prot  Length:55

    Alignment length:48
                                    14        24        34        44        
          ANTA_HIRME      5 TCGGETCSAAQVCLKGKCVCNEVHCRIRCKYGLKKDENGCEYPCSCAK   52
               SCOP domains d1hiaj_ J: Hirustasin                            SCOP domains
               CATH domains 1hiaJ00 J:5-52 Antistasin; domain 1              CATH domains
               Pfam domains ------------------------------------------------ Pfam domains
     Sec.struct. author (1) .hhh......---hhheeee..eee....................... Sec.struct. author (1)
     Sec.struct. author (2) ----------eeee---------------------------------- Sec.struct. author (2)
                 SAPs(SNPs) ------------------------------------------------ SAPs(SNPs)
                PROSITE (2) -------------------ANTISTASIN  PDB: J:24-50   -- PROSITE (2)
                 Transcript ------------------------------------------------ Transcript
                1hia J    5 TCGGETCSAAQVCLKGKCVCNEVHCRIRCKYGLKKDENGCEYPCSCAK   52
                                    14        24        34        44

Chain X from PDB  Type:PROTEIN  Length:80
 aligned with KLK_PIG | P00752 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:80
                                    17        27        37        47        57        67        77        87
             KLK_PIG      8 IIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGRHNLFENENTAQFFGVTADFPHPGFNLS   87
               SCOP domains d1hia.2 X:,Y: Kallikrein A                                                       SCOP domains
               CATH domains 1hiaX00 X:16-95B Trypsin-like serine proteases                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee..eeeeeeeeee..eeee.hhh.....eeee............eeeeeeeeee....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: X:16-95B UniProt: 8-243                                        PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------TRYPSI-------------------------------------- PROSITE (3)
                 Transcript -------------------------------------------------------------------------------- Transcript
                1hia X   16 IIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGRHNLFENENTAQFFGVTADFPHPGFNLS  95B
                                    25        35||      46        56        66||      77        87       95B
                                               36|                           67|                        95A|
                                                38                            69                         95B

Chain Y from PDB  Type:PROTEIN  Length:150
 aligned with KLK_PIG | P00752 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:150
                                   106       116       126       136       146       156       166       176       186       196       206       216       226       236       246
             KLK_PIG     97 GKDYSHDLMLLRLQSPAKITDAVKVLELPTQEPELGSTCEASGWGSIEPGPDBFEFPDEIQCVQLTLLQNTFCABAHPBKVTESMLCAGYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWINDTITENP  246
               SCOP domains d1hia.2 X:,Y: Kallikrein A                                                                                                                             SCOP domains
               CATH domains 1hiaY00 Y:96-246 Trypsin-like serine proteases                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ........eeeee........................eeeeee.................eeeeeeee..hhhhhh........eeeee...............eeee..eeeeeeeeee.........eeeeehhh.hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: - UniProt: 8-243                                                                                                                 --- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------TRYPSIN_SER ------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1hia Y   96 GKDYSHDLMLLRLQSPAKITDAVKVLELPTQEPELGSTCEASGWGSIEPGPDDFEFPDEIQCVQLTLLQNTFCADAHPDKVTESMLCAGYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWIDDTITENP  246
                                   105       115       125|  ||  137      147A |     155       165       175       184   |   193       203|      217   |   226       236       246
                                                       125|  ||           147A |                                 184A 188A             203|         221A                          
                                                        127  ||             148A                                                        208                                       
                                                           130|                                                                                                                   
                                                            132

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Beta Barrel (4804)

Topology: Thrombin, subunit H (1535)

Homologous Superfamily: Trypsin-like serine proteases (1488)

Pig (Sus scrofa) (115)

1a	1hiaA00	A:16-95B
1b	1hiaX00	X:16-95B
1c	1hiaB00	B:96-246
1d	1hiaY00	Y:96-246

Architecture: Ribbon (789)

Topology: Antistasin; domain 1 (8)

Homologous Superfamily: Antistasin; domain 1 (8)

Pig (Sus scrofa) (3)

2a	1hiaI00	I:5-52
2b	1hiaJ00	J:5-52

(no "Pfam Domain" information available for 1HIA)

Asymmetric Unit(hide GO term definitions)

Chain A,B,X,Y (KLK_PIG | P00752)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
	GO:0008236	serine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

Chain I,J (ANTA_HIRME | P80302)

molecular function
	GO:0004857	enzyme inhibitor activity	Binds to and stops, prevents or reduces the activity of an enzyme.
	GO:0008201	heparin binding	Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
	GO:0030414	peptidase inhibitor activity	Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
	GO:0004867	serine-type endopeptidase inhibitor activity	Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
	GO:0050819	negative regulation of coagulation	Any process that stops, prevents, or reduces the frequency, rate or extent of coagulation.
	GO:0010951	negative regulation of endopeptidase activity	Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
	GO:0010466	negative regulation of peptidase activity	Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1hia)

	Sites
(no "Sites" information available for 1hia)

	Cis Peptide Bonds
		Gly B:147A - Pro B:147	[ RasMol ]
		Gly Y:147A - Pro Y:147	[ RasMol ]
		Thr B:218 - Pro B:219	[ RasMol ]
		Thr Y:218 - Pro Y:219	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1hia
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ANTA_HIRME \| P80302
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	KLK_PIG \| P00752
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.21.35
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ANTA_HIRME \| P80302
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	KLK_PIG \| P00752
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ANTA_HIRME \| P80302	:	1bx7 1bx8
	KLK_PIG \| P00752	:	2kai 2pka

(no "Related Entries Specified in the PDB File" available for 1HIA)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (20, 20)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (4, 8)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 6)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File