|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (3, 19)
|
Asymmetric Unit (19, 19)
|
(no "SS Bond" information available for 1LNX) |
(no "Cis Peptide Bond" information available for 1LNX) |
(no "SAP(SNP)/Variant" information available for 1LNX) |
(no "PROSITE Motif" information available for 1LNX) |
(no "Exon" information available for 1LNX) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:74 aligned with Q8ZYG5_PYRAE | Q8ZYG5 from UniProtKB/TrEMBL Length:80 Alignment length:74 80 17 27 37 47 57 67 77 | Q8ZYG5_PYRAE 8 CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVP- - SCOP domains d1lnxa_ A: Archaeal homoheptameric Sm protein SCOP domains CATH domains 1lnxA00 A:8-81 [code=2.30.30.100, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------- Transcript 1lnx A 8 CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVPG 81 17 27 37 47 57 67 77 Chain B from PDB Type:PROTEIN Length:73 aligned with Q8ZYG5_PYRAE | Q8ZYG5 from UniProtKB/TrEMBL Length:80 Alignment length:73 17 27 37 47 57 67 77 Q8ZYG5_PYRAE 8 CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVP 80 SCOP domains d1lnxb_ B: Archaeal homoheptameric Sm protein SCOP domains CATH domains 1lnxB00 B:8-80 [code=2.30.30.100, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------- Transcript 1lnx B 8 CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVP 80 17 27 37 47 57 67 77 Chain C from PDB Type:PROTEIN Length:73 aligned with Q8ZYG5_PYRAE | Q8ZYG5 from UniProtKB/TrEMBL Length:80 Alignment length:73 17 27 37 47 57 67 77 Q8ZYG5_PYRAE 8 CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVP 80 SCOP domains d1lnxc_ C: Archaeal homoheptameric Sm protein SCOP domains CATH domains 1lnxC00 C:8-80 [code=2.30.30.100, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------- Transcript 1lnx C 8 CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVP 80 17 27 37 47 57 67 77 Chain D from PDB Type:PROTEIN Length:73 aligned with Q8ZYG5_PYRAE | Q8ZYG5 from UniProtKB/TrEMBL Length:80 Alignment length:73 17 27 37 47 57 67 77 Q8ZYG5_PYRAE 8 CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVP 80 SCOP domains d1lnxd_ D: Archaeal homoheptameric Sm protein SCOP domains CATH domains 1lnxD00 D:8-80 [code=2.30.30.100, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------- Transcript 1lnx D 8 CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVP 80 17 27 37 47 57 67 77 Chain E from PDB Type:PROTEIN Length:73 aligned with Q8ZYG5_PYRAE | Q8ZYG5 from UniProtKB/TrEMBL Length:80 Alignment length:73 17 27 37 47 57 67 77 Q8ZYG5_PYRAE 8 CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVP 80 SCOP domains d1lnxe_ E: Archaeal homoheptameric Sm protein SCOP domains CATH domains 1lnxE00 E:8-80 [code=2.30.30.100, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------- Transcript 1lnx E 8 CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVP 80 17 27 37 47 57 67 77 Chain F from PDB Type:PROTEIN Length:74 aligned with Q8ZYG5_PYRAE | Q8ZYG5 from UniProtKB/TrEMBL Length:80 Alignment length:74 80 17 27 37 47 57 67 77 | Q8ZYG5_PYRAE 8 CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVP- - SCOP domains d1lnxf_ F: Archaeal homoheptameric Sm protein SCOP domains CATH domains 1lnxF00 F:8-81 [code=2.30.30.100, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------- Transcript 1lnx F 8 CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVPG 81 17 27 37 47 57 67 77 Chain G from PDB Type:PROTEIN Length:73 aligned with Q8ZYG5_PYRAE | Q8ZYG5 from UniProtKB/TrEMBL Length:80 Alignment length:73 17 27 37 47 57 67 77 Q8ZYG5_PYRAE 8 CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVP 80 SCOP domains d1lnxg_ G: Archaeal homoheptameric Sm protein SCOP domains CATH domains 1lnxG00 G:8-80 [code=2.30.30.100, no name defined] CATH domains Pfam domains (1) ------LSM-1lnxG01 G:14-78 -- Pfam domains (1) Pfam domains (2) ------LSM-1lnxG02 G:14-78 -- Pfam domains (2) Pfam domains (3) ------LSM-1lnxG03 G:14-78 -- Pfam domains (3) Pfam domains (4) ------LSM-1lnxG04 G:14-78 -- Pfam domains (4) Pfam domains (5) ------LSM-1lnxG05 G:14-78 -- Pfam domains (5) Pfam domains (6) ------LSM-1lnxG06 G:14-78 -- Pfam domains (6) Pfam domains (7) ------LSM-1lnxG07 G:14-78 -- Pfam domains (7) SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------- Transcript 1lnx G 8 CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVP 80 17 27 37 47 57 67 77
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D,E,F,G (Q8ZYG5_PYRAE | Q8ZYG5)
|
|
|
|
|
|
|