Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF AN SM-LIKE PROTEIN (AF-SM1) FROM ARCHAEOGLOBUS FULGIDUS COMPLEXED WITH SHORT POLY-U RNA
 
Authors :  I. Toro, S. Thore, C. Mayer, J. Basquin, B. Seraphin, D. Suck
Date :  28 Feb 01  (Deposition) - 28 Aug 01  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.75
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,U,Y
Biol. Unit 1:  A,B,C,D,E,F,G,U  (1x)
Biol. Unit 2:  H,I,J,K,L,M,N,Y  (1x)
Keywords :  Snrnp, Sm, Core Snrnp Domain, Rna Binding Protein, Single- Stranded Rna Binding Protein, Rna Binding Protein/Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  I. Toro, S. Thore, C. Mayer, J. Basquin, B. Seraphin, D. Suck
Rna Binding In An Sm Core Domain: X-Ray Structure And Functional Analysis Of An Archaeal Sm Protein Complex.
Embo J. V. 20 2293 2001
PubMed-ID: 11331594  |  Reference-DOI: 10.1093/EMBOJ/20.9.2293
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 5'-R(*UP*UP*U)-3'
    ChainsU, Y
    EngineeredYES
    SyntheticYES
 
Molecule 2 - PUTATIVE SNRNP SM-LIKE PROTEIN AF-SM1
    ChainsA, B, C, D, E, F, G, H, I, J, K, L, M, N
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidMODIFIED PET24D
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneAF0875
    Organism ScientificARCHAEOGLOBUS FULGIDUS
    Organism Taxid2234
    SynonymAF-SM1

 Structural Features

(-) Chains, Units

  12345678910111213141516
Asymmetric Unit ABCDEFGHIJKLMNUY
Biological Unit 1 (1x)ABCDEFG       U 
Biological Unit 2 (1x)       HIJKLMN Y

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1URI4Ligand/IonURIDINE
Biological Unit 1 (1, 3)
No.NameCountTypeFull Name
1URI3Ligand/IonURIDINE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1URI1Ligand/IonURIDINE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE A:36 , URI A:201 , HIS B:37 , ASN B:39 , ARG B:63 , GLY B:64 , ASP B:65 , URI C:301BINDING SITE FOR RESIDUE URI B 101
2AC2SOFTWAREHIS A:37 , ASN A:39 , ARG A:63 , GLY A:64 , ASP A:65 , URI B:101 , ILE G:36 , HIS G:37 , MET G:38 , U U:3BINDING SITE FOR RESIDUE URI A 201
3AC3SOFTWAREILE B:36 , HIS B:37 , MET B:38 , ASP B:65 , URI B:101 , HIS C:37 , ASN C:39 , ARG C:63 , GLY C:64 , ASP C:65BINDING SITE FOR RESIDUE URI C 301
4AC4SOFTWAREHIS H:37 , ASN H:39 , ARG H:63 , GLY H:64 , ASP H:65 , ARG I:63 , ILE N:36 , MET N:38BINDING SITE FOR RESIDUE URI H 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1I5L)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1I5L)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1I5L)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1I5L)

(-) Exons   (0, 0)

(no "Exon" information available for 1I5L)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:71
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:71
                                    12        22        32        42        52        62        72 
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
               SCOP domains d1i5la_ A: Archaeal homoheptameric Sm protein                           SCOP domains
               CATH domains 1i5lA00 A:3-73  [code=2.30.30.100, no name defined]                     CATH domains
               Pfam domains ----------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------- Transcript
                  1i5l A  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
                                    12        22        32        42        52        62        72 

Chain B from PDB  Type:PROTEIN  Length:73
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:73
                                    12        22        32        42        52        62        72   
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAPG 75
               SCOP domains d1i5lb_ B: Archaeal homoheptameric Sm protein                             SCOP domains
               CATH domains 1i5lB00 B:3-75  [code=2.30.30.100, no name defined]                       CATH domains
               Pfam domains ------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeeee...eeeeeeeeee........eeeeee....eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                  1i5l B  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAPG 75
                                    12        22        32        42        52        62        72   

Chain C from PDB  Type:PROTEIN  Length:74
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:74
                                    10        20        30        40        50        60        70    
            RUXX_ARCFU    1 MPPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5lc_ C: Archaeal homoheptameric Sm protein                              SCOP domains
               CATH domains 1i5lC00 C:1-74  [code=2.30.30.100, no name defined]                        CATH domains
               Pfam domains -------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------- Transcript
                  1i5l C  1 MPPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    10        20        30        40        50        60        70    

Chain D from PDB  Type:PROTEIN  Length:73
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:73
                                    11        21        31        41        51        61        71   
            RUXX_ARCFU    2 PPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5ld_ D: Archaeal homoheptameric Sm protein                             SCOP domains
               CATH domains 1i5lD00 D:2-74  [code=2.30.30.100, no name defined]                       CATH domains
               Pfam domains ------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                  1i5l D  2 PPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    11        21        31        41        51        61        71   

Chain E from PDB  Type:PROTEIN  Length:71
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:71
                                    12        22        32        42        52        62        72 
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
               SCOP domains d1i5le_ E: Archaeal homoheptameric Sm protein                           SCOP domains
               CATH domains 1i5lE00 E:3-73  [code=2.30.30.100, no name defined]                     CATH domains
               Pfam domains ----------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------- Transcript
                  1i5l E  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
                                    12        22        32        42        52        62        72 

Chain F from PDB  Type:PROTEIN  Length:72
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:72
                                    12        22        32        42        52        62        72  
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5lf_ F: Archaeal homoheptameric Sm protein                            SCOP domains
               CATH domains 1i5lF00 F:3-74  [code=2.30.30.100, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeee......eeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                  1i5l F  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    12        22        32        42        52        62        72  

Chain G from PDB  Type:PROTEIN  Length:72
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:72
                                    12        22        32        42        52        62        72  
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5lg_ G: Archaeal homoheptameric Sm protein                            SCOP domains
               CATH domains 1i5lG00 G:3-74  [code=2.30.30.100, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                  1i5l G  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    12        22        32        42        52        62        72  

Chain H from PDB  Type:PROTEIN  Length:72
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:72
                                    12        22        32        42        52        62        72  
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5lh_ H: Archaeal homoheptameric Sm protein                            SCOP domains
               CATH domains 1i5lH00 H:3-74  [code=2.30.30.100, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                  1i5l H  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    12        22        32        42        52        62        72  

Chain I from PDB  Type:PROTEIN  Length:73
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:73
                                    10        20        30        40        50        60        70   
            RUXX_ARCFU    1 MPPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
               SCOP domains d1i5li_ I: Archaeal homoheptameric Sm protein                             SCOP domains
               CATH domains 1i5lI00 I:1-73  [code=2.30.30.100, no name defined]                       CATH domains
               Pfam domains ------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------- Transcript
                  1i5l I  1 MPPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
                                    10        20        30        40        50        60        70   

Chain J from PDB  Type:PROTEIN  Length:72
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:72
                                    12        22        32        42        52        62        72  
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5lj_ J: Archaeal homoheptameric Sm protein                            SCOP domains
               CATH domains 1i5lJ00 J:3-74  [code=2.30.30.100, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..ee...eeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                  1i5l J  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    12        22        32        42        52        62        72  

Chain K from PDB  Type:PROTEIN  Length:72
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:72
                                    12        22        32        42        52        62        72  
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5lk_ K: Archaeal homoheptameric Sm protein                            SCOP domains
               CATH domains 1i5lK00 K:3-74  [code=2.30.30.100, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                  1i5l K  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    12        22        32        42        52        62        72  

Chain L from PDB  Type:PROTEIN  Length:72
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:72
                                    12        22        32        42        52        62        72  
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
               SCOP domains d1i5ll_ L: Archaeal homoheptameric Sm protein                            SCOP domains
               CATH domains 1i5lL00 L:3-74  [code=2.30.30.100, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                  1i5l L  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPAP 74
                                    12        22        32        42        52        62        72  

Chain M from PDB  Type:PROTEIN  Length:72
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:72
                                    11        21        31        41        51        61        71  
            RUXX_ARCFU    2 PPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
               SCOP domains d1i5lm_ M: Archaeal homoheptameric Sm protein                            SCOP domains
               CATH domains 1i5lM00 M:2-73  [code=2.30.30.100, no name defined]                      CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeee......eeeeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                  1i5l M  2 PPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
                                    11        21        31        41        51        61        71  

Chain N from PDB  Type:PROTEIN  Length:71
 aligned with RUXX_ARCFU | O29386 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:71
                                    12        22        32        42        52        62        72 
            RUXX_ARCFU    3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
               SCOP domains d1i5ln_ N: Archaeal homoheptameric Sm protein                           SCOP domains
               CATH domains 1i5lN00 N:3-73  [code=2.30.30.100, no name defined]                     CATH domains
               Pfam domains ----------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeee....eeeeeeeee.....eeeeeeeeee..eeeeeeeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------- Transcript
                  1i5l N  3 PRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVFVSPA 73
                                    12        22        32        42        52        62        72 

Chain U from PDB  Type:RNA  Length:3
                                  
                  1i5l U  1 UUU  3

Chain Y from PDB  Type:RNA  Length:3
                                  
                  1i5l Y  1 UUU  3

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 14)

Asymmetric Unit

(-) CATH Domains  (1, 14)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)
1a1i5lA00A:3-73
1b1i5lE00E:3-73
1c1i5lN00N:3-73
1d1i5lF00F:3-74
1e1i5lG00G:3-74
1f1i5lH00H:3-74
1g1i5lJ00J:3-74
1h1i5lK00K:3-74
1i1i5lL00L:3-74
1j1i5lM00M:2-73
1k1i5lB00B:3-75
1l1i5lD00D:2-74
1m1i5lI00I:1-73
1n1i5lC00C:1-74

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1I5L)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G,H,I,J,K,L,M,N   (RUXX_ARCFU | O29386)
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    URI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1i5l)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1i5l
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RUXX_ARCFU | O29386
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RUXX_ARCFU | O29386
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RUXX_ARCFU | O293861i4k

(-) Related Entries Specified in the PDB File

1b34 CRYSTAL STRUCTURE OF THE D1D2 SUB-COMPLEX FROM THE HUMAN CORE SNRNP DOMAIN
1d3b CRYSTAL STRUCTURE OF THE D3B SUBCOMPLEX OF THE HUMAN CORE SNRNP DOMAIN AT 2.0 A RESOLUTION
1i4k CRYSTAL STRUCTURE OF AN SM-LIKE PROTEIN (AF-SM1) FROM ARCHAEOGLOBUS FULGIDUS AT 2.5 A RESOLUTION