|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 16) |
Asymmetric Unit (16, 16)
|
(no "SS Bond" information available for 1JBM) |
(no "Cis Peptide Bond" information available for 1JBM) |
(no "SAP(SNP)/Variant" information available for 1JBM) |
(no "PROSITE Motif" information available for 1JBM) |
(no "Exon" information available for 1JBM) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:78 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot Length:81 Alignment length:78 81 18 28 38 48 58 68 78 | RUXX_METTH 9 VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP----- - SCOP domains d1jbma_ A: Archaeal homoheptameric Sm protein SCOP domains CATH domains 1jbmA00 A:9-86 [code=2.30.30.100, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------ Transcript 1jbm A 9 VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAA 86 18 28 38 48 58 68 78 Chain B from PDB Type:PROTEIN Length:73 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot Length:81 Alignment length:73 81 19 29 39 49 59 69 79 | RUXX_METTH 10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP- - SCOP domains d1jbmb_ B: Archaeal homoheptameric Sm protein SCOP domains CATH domains 1jbmB00 B:10-82 [code=2.30.30.100, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------- Transcript 1jbm B 10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRG 82 19 29 39 49 59 69 79 Chain C from PDB Type:PROTEIN Length:77 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot Length:81 Alignment length:77 81 19 29 39 49 59 69 79 | RUXX_METTH 10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP----- - SCOP domains d1jbmc_ C: Archaeal homoheptameric Sm protein SCOP domains CATH domains 1jbmC00 C:10-86 [code=2.30.30.100, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------- Transcript 1jbm C 10 NVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAA 86 19 29 39 49 59 69 79 Chain D from PDB Type:PROTEIN Length:71 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot Length:81 Alignment length:71 20 30 40 50 60 70 80 RUXX_METTH 11 VQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP 81 SCOP domains d1jbmd_ D: Archaeal homoheptameric Sm protein SCOP domains CATH domains 1jbmD00 D:11-81 [code=2.30.30.100, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------- Transcript 1jbm D 11 VQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISR 81 20 30 40 50 60 70 80 Chain E from PDB Type:PROTEIN Length:75 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot Length:81 Alignment length:75 81 18 28 38 48 58 68 78 | RUXX_METTH 9 VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP-- - SCOP domains d1jbme_ E: Archaeal homoheptameric Sm protein SCOP domains CATH domains 1jbmE00 E:9-83 [code=2.30.30.100, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------- Transcript 1jbm E 9 VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGK 83 18 28 38 48 58 68 78 Chain F from PDB Type:PROTEIN Length:73 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot Length:81 Alignment length:73 81 20 30 40 50 60 70 80| RUXX_METTH 11 VQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP-- - SCOP domains d1jbmf_ F: Archaeal homoheptameric Sm protein SCOP domains CATH domains 1jbmF00 F:11-83 [code=2.30.30.100, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------- Transcript 1jbm F 11 VQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGK 83 20 30 40 50 60 70 80 Chain G from PDB Type:PROTEIN Length:74 aligned with RUXX_METTH | O26745 from UniProtKB/Swiss-Prot Length:81 Alignment length:74 81 21 31 41 51 61 71 81 RUXX_METTH 12 QRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISP---- - SCOP domains d1jbmg_ G: Archaeal homoheptameric Sm protein SCOP domains CATH domains 1jbmG00 G:12-85 [code=2.30.30.100, no name defined] CATH domains Pfam domains (1) ----LSM-1jbmG01 G:16-80 ----- Pfam domains (1) Pfam domains (2) ----LSM-1jbmG02 G:16-80 ----- Pfam domains (2) Pfam domains (3) ----LSM-1jbmG03 G:16-80 ----- Pfam domains (3) Pfam domains (4) ----LSM-1jbmG04 G:16-80 ----- Pfam domains (4) Pfam domains (5) ----LSM-1jbmG05 G:16-80 ----- Pfam domains (5) Pfam domains (6) ----LSM-1jbmG06 G:16-80 ----- Pfam domains (6) Pfam domains (7) ----LSM-1jbmG07 G:16-80 ----- Pfam domains (7) SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------- Transcript 1jbm G 12 QRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLA 85 21 31 41 51 61 71 81
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B,C,D,E,F,G (RUXX_METTH | O26745)
|
|
|
|
|
|
|