|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 54)| Asymmetric Unit (2, 54) Biological Unit 1 (0, 0) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1IU5) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1IU5) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1IU5) |
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1IU5) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:51 aligned with RUBR_PYRFU | P24297 from UniProtKB/Swiss-Prot Length:54 Alignment length:51 11 21 31 41 51 RUBR_PYRFU 2 AKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKL 52 SCOP domains d1iu5a_ A: Rubredoxin SCOP domains CATH domains 1iu5A00 A:1-51 [code=2.20.28.10, no name defined] CATH domains Pfam domains --------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------RUBREDOXIN --------- PROSITE Transcript --------------------------------------------------- Transcript 1iu5 A 1 AKYVCKICGYIYDEDAGDPDNGVSPGTKFEEIPDDWVCPICGAPKSEFEKL 51 10 20 30 40 50
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1IU5) |
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (RUBR_PYRFU | P24297)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|