|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 111)| Asymmetric Unit (4, 111) Biological Unit 1 (2, 6) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 4AR4) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 4AR4) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 4AR4) |
PROSITE Motifs (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 4AR4) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:54 aligned with RUBR_PYRFU | P24297 from UniProtKB/Swiss-Prot Length:54 Alignment length:54 10 20 30 40 50 RUBR_PYRFU 1 MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED 54 SCOP domains d4ar4a_ A: Rubredoxin SCOP domains CATH domains ------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------ SAPs(SNPs) PROSITE (1) RUBREDOXIN_LIKE PDB: A:0-51 UniProt: 1-52 -- PROSITE (1) PROSITE (2) --------------------------------RUBREDOXIN ----------- PROSITE (2) Transcript ------------------------------------------------------ Transcript 4ar4 A 0 MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED 53 9 19 29 39 49
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 4AR4) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 4AR4) |
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (RUBR_PYRFU | P24297)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|