Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE CRYOFROZEN ATOMIC RESOLUTION X-RAY CRYSTAL STRUCTURE OF PERDEUTERATED PYROCOCCUS FURIOSUS RUBREDOXIN (100K, 0.59A RESOLUTION)
 
Authors :  M. G. Cuypers, S. A. Mason, E. Mossou, M. Haertlein, V. T. Forsyth
Date :  04 May 17  (Deposition) - 07 Jun 17  (Release) - 07 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  0.59
Chains :  Asym./Biol. Unit :  A
Keywords :  Perdeuterated Rubredoxin, Pyrococcus Furiosus, Atomic Resolution, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. G. Cuypers, S. A. Mason, E. Mossou, M. Haertlein, V. T. Forsyth
The Cryofrozen Atomic Resolution X-Ray Crystal Structure Of Perdeuterated Pyrococcus Furiosus Rubredoxin (100K, 0. 59A Resolution)
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - RUBREDOXIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI 'BL21-GOLD(DE3)PLYSS AG'
    Expression System Taxid866768
    Expression System Vector TypePET28
    GeneRUB, PF1282
    Organism ScientificPYROCOCCUS FURIOSUS (STRAIN ATCC 43587 / DSM 3638 / JCM 8422 / VC1)
    Organism Taxid186497
    StrainATCC 43587 / DSM 3638 / JCM 8422 / VC1
    SynonymRD

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 4)

Asymmetric/Biological Unit (4, 4)
No.NameCountTypeFull Name
1FE1Ligand/IonFE (III) ION
2K1Ligand/IonPOTASSIUM ION
3NA1Ligand/IonSODIUM ION
4PO41Ligand/IonPHOSPHATE ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:5 , CYS A:8 , CYS A:38 , CYS A:41binding site for residue FE A 101
2AC2SOFTWAREGLU A:30 , HOH A:251 , HOH A:285 , HOH A:292 , HOH A:307 , HOH A:309 , HOH A:315binding site for residue NA A 102
3AC3SOFTWAREGLU A:30 , HOH A:251 , HOH A:285 , HOH A:292 , HOH A:307 , HOH A:309 , HOH A:315binding site for residue K A 103
4AC4SOFTWAREMET A:0 , ASP A:15 , PRO A:39 , ASP A:53 , HOH A:206 , HOH A:214 , HOH A:224 , HOH A:226 , HOH A:234binding site for residue PO4 A 104

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5NW3)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5NW3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5NW3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5NW3)

(-) Exons   (0, 0)

(no "Exon" information available for 5NW3)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:54
                                                                                     
               SCOP domains ------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeee.....eee....hhhhh.....hhhhh...........hhh.eee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------ Transcript
                  5nw3 A  0 MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED 53
                                     9        19        29        39        49    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5NW3)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5NW3)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5NW3)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5nw3)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5nw3
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RUBR_PYRFU | P24297
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RUBR_PYRFU | P24297
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RUBR_PYRFU | P242971bq8 1bq9 1brf 1caa 1cad 1iu5 1iu6 1qcv 1rwd 1vcx 1zrp 2pvx 3kyu 3kyv 3kyw 3kyx 3kyy 3ryg 3rz6 3rzt 3ss2 4ar3 4ar4 4ar5 4ar6 4k9f 5ai2 5ai3

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5NW3)