1YDI - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   HUMAN VINCULIN HEAD DOMAIN (VH1, 1-258) IN COMPLEX WITH HUMAN ALPHA-ACTININ'S VINCULIN-BINDING SITE (RESIDUES 731-760)

Authors :   T. Izard

Date :   23 Dec 04 (Deposition) - 19 Jul 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym./Biol. Unit : A,B

Keywords :   Cell Adhesion, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. R. Bois, R. A. Borgon, C. Vonrhein, T. Izard
Structural Dynamics Of {Alpha}-Actinin-Vinculin Interactions.
Mol. Cell. Biol. V. 14 6112 2005
PubMed-ID: 15988023 | Reference-DOI: 10.1128/MCB.25.14.6112-6122.2005
(for further references see the PDB file header)

Molecule 1 - VINCULIN ISOFORM VCL
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET3
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

Molecule 2 - ALPHA-ACTININ 4
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	ACTN4
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	NON-MUSCLE ALPHA-ACTININ 4, F-ACTIN CROSS LINKING PROTEIN

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1YDI)

(no "Site" information available for 1YDI)

(no "SS Bond" information available for 1YDI)

(no "Cis Peptide Bond" information available for 1YDI)

Asymmetric/Biological Unit (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_037667	V	234	L	VINC_HUMAN	Polymorphism	17853882	A	V	234	L
2	UniProt	VAR_072117	N	748	D	ACTN4_HUMAN	Disease (FSGS1)	---	B	N	755	D

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	VINCULIN_1	PS00663	Vinculin family talin-binding region signature.	VINC_HUMAN	162-182	1	A:162-182

Asymmetric/Biological Unit (7, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000211998	1a	ENSE00002146319	chr10:75757872-75758133	262	VINC_HUMAN	1-56	56	1	A:1-56 (gaps)	56
1.2a	ENST00000211998	2a	ENSE00001607712	chr10:75802841-75802911	71	VINC_HUMAN	57-80	24	1	A:57-80	24
1.4	ENST00000211998	4	ENSE00001024254	chr10:75830428-75830578	151	VINC_HUMAN	80-130	51	1	A:80-130	51
1.5	ENST00000211998	5	ENSE00001024245	chr10:75830733-75830841	109	VINC_HUMAN	131-167	37	1	A:131-167	37
1.6	ENST00000211998	6	ENSE00001024249	chr10:75832488-75832610	123	VINC_HUMAN	167-208	42	1	A:167-208	42
1.7a	ENST00000211998	7a	ENSE00001024263	chr10:75834501-75834661	161	VINC_HUMAN	208-261	54	1	A:208-258	51
1.8	ENST00000211998	8	ENSE00001024248	chr10:75842212-75842302	91	VINC_HUMAN	262-292	31	0	-	-
1.9a	ENST00000211998	9a	ENSE00000986356	chr10:75843124-75843271	148	VINC_HUMAN	292-341	50	0	-	-
1.10	ENST00000211998	10	ENSE00000986357	chr10:75848954-75849107	154	VINC_HUMAN	341-392	52	0	-	-
1.11	ENST00000211998	11	ENSE00000986358	chr10:75849781-75849956	176	VINC_HUMAN	393-451	59	0	-	-
1.12	ENST00000211998	12	ENSE00001024262	chr10:75854029-75854219	191	VINC_HUMAN	451-515	65	0	-	-
1.13	ENST00000211998	13	ENSE00000986360	chr10:75855414-75855613	200	VINC_HUMAN	515-581	67	0	-	-
1.14	ENST00000211998	14	ENSE00000986361	chr10:75856962-75857090	129	VINC_HUMAN	582-624	43	0	-	-
1.15a	ENST00000211998	15a	ENSE00000986362	chr10:75860706-75860855	150	VINC_HUMAN	625-674	50	0	-	-
1.16	ENST00000211998	16	ENSE00000986363	chr10:75863578-75863686	109	VINC_HUMAN	675-711	37	0	-	-
1.17c	ENST00000211998	17c	ENSE00000986364	chr10:75864809-75865111	303	VINC_HUMAN	711-812	102	0	-	-
1.18	ENST00000211998	18	ENSE00000986365	chr10:75866988-75867112	125	VINC_HUMAN	812-853	42	0	-	-
1.19b	ENST00000211998	19b	ENSE00000834577	chr10:75868729-75868914	186	VINC_HUMAN	854-915	62	0	-	-
1.20	ENST00000211998	20	ENSE00000709651	chr10:75871667-75871870	204	VINC_HUMAN	916-983	68	0	-	-
1.21	ENST00000211998	21	ENSE00000709670	chr10:75873942-75874145	204	VINC_HUMAN	984-1051	68	0	-	-
1.22	ENST00000211998	22	ENSE00000986366	chr10:75874553-75874657	105	VINC_HUMAN	1052-1086	35	0	-	-
1.23a	ENST00000211998	23a	ENSE00001373600	chr10:75877781-75879910	2130	VINC_HUMAN	1087-1134	48	0	-	-

2.1a	ENST00000252699	1a	ENSE00001909908	chr19:39138310-39138547	238	ACTN4_HUMAN	1-54	54	0	-	-
2.3b	ENST00000252699	3b	ENSE00001756201	chr19:39191240-39191354	115	ACTN4_HUMAN	55-93	39	0	-	-
2.4	ENST00000252699	4	ENSE00001633778	chr19:39191642-39191761	120	ACTN4_HUMAN	93-133	41	0	-	-
2.5	ENST00000252699	5	ENSE00001741382	chr19:39195574-39195660	87	ACTN4_HUMAN	133-162	30	0	-	-
2.6	ENST00000252699	6	ENSE00001803629	chr19:39196684-39196771	88	ACTN4_HUMAN	162-191	30	0	-	-
2.7	ENST00000252699	7	ENSE00001686766	chr19:39198757-39198835	79	ACTN4_HUMAN	191-217	27	0	-	-
2.8b	ENST00000252699	8b	ENSE00001611972	chr19:39200035-39200116	82	ACTN4_HUMAN	218-245	28	0	-	-
2.9	ENST00000252699	9	ENSE00000895787	chr19:39200897-39200982	86	ACTN4_HUMAN	245-273	29	0	-	-
2.11	ENST00000252699	11	ENSE00000895786	chr19:39205109-39205201	93	ACTN4_HUMAN	274-304	31	0	-	-
2.12c	ENST00000252699	12c	ENSE00001680426	chr19:39207726-39207956	231	ACTN4_HUMAN	305-381	77	0	-	-
2.13	ENST00000252699	13	ENSE00001603394	chr19:39208567-39208714	148	ACTN4_HUMAN	382-431	50	0	-	-
2.14a	ENST00000252699	14a	ENSE00000895781	chr19:39212178-39212328	151	ACTN4_HUMAN	431-481	51	0	-	-
2.15b	ENST00000252699	15b	ENSE00000895780	chr19:39214254-39214362	109	ACTN4_HUMAN	481-517	37	0	-	-
2.16	ENST00000252699	16	ENSE00000895779	chr19:39214577-39214717	141	ACTN4_HUMAN	518-564	47	0	-	-
2.17	ENST00000252699	17	ENSE00000895778	chr19:39214797-39214979	183	ACTN4_HUMAN	565-625	61	0	-	-
2.18a	ENST00000252699	18a	ENSE00000895777	chr19:39215071-39215205	135	ACTN4_HUMAN	626-670	45	0	-	-
2.19b	ENST00000252699	19b	ENSE00001749718	chr19:39216364-39216543	180	ACTN4_HUMAN	671-730	60	0	-	-
2.20	ENST00000252699	20	ENSE00001675072	chr19:39217597-39217743	147	ACTN4_HUMAN	731-779	49	1	B:741-764	24
2.21b	ENST00000252699	21b	ENSE00000895774	chr19:39218586-39218666	81	ACTN4_HUMAN	780-806	27	0	-	-
2.23	ENST00000252699	23	ENSE00000895773	chr19:39219636-39219794	159	ACTN4_HUMAN	807-859	53	0	-	-
2.24d	ENST00000252699	24d	ENSE00001731568	chr19:39219914-39222223	2310	ACTN4_HUMAN	860-911	52	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:256
 aligned with VINC_HUMAN | P18206 from UniProtKB/Swiss-Prot  Length:1134

    Alignment length:263
                                 1                                                                                                                                                                                                                                                                 
                                 |   5        15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255   
           VINC_HUMAN     - -----MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW 258
               SCOP domains d1ydia1 A:-4-128 automated matche       s                                                                                            d1ydia2 A:129-258 automated matches                                                                                                SCOP domains
               CATH domains 1ydiA01 A:-4-129 vbs2 fragment of        talin                                                                                        1ydiA02 A:130-258  [code=1.20.120.230, no name defined]                                                                           CATH domains
               Pfam domains -------Vinculin-1ydiA01 A:3-258                                                                                                                                                                                                                                         Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhhhhh..-------....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------VINCULIN_1           ---------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) -----Exon 1.1a  PDB: A:1-56 (gaps) UniProt: 1-56             Exon 1.2a  PDB: A:57-80 --------------------------------------------------Exon 1.5  PDB: A:131-167             ----------------------------------------Exon 1.7a  PDB: A:208-258 UniProt: 208-261          Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------Exon 1.4  PDB: A:80-130 UniProt: 80-130            ------------------------------------Exon 1.6  PDB: A:167-208 UniProt: 167-208 -------------------------------------------------- Transcript 1 (2)
                 1ydi A  -4 HHHHHMPVFHTRTIESILEPVAQQISHLVIMHE-------AIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW 258
                                     5        15        25  |      -|       45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255   
                                                           28      36

Chain B from PDB  Type:PROTEIN  Length:24
 aligned with ACTN4_HUMAN | O43707 from UniProtKB/Swiss-Prot  Length:911

    Alignment length:24
                                   743       753    
          ACTN4_HUMAN   734 VGWEQLLTTIARTINEVENQILTR 757
               SCOP domains ------------------------ SCOP domains
               CATH domains ------------------------ CATH domains
               Pfam domains Spectrin-1ydiB01   ----- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------D--------- SAPs(SNPs)
                    PROSITE ------------------------ PROSITE
               Transcript 2 Exon 2.20  PDB: B:741-76 Transcript 2
                 1ydi B 741 VGWEQLLTTIARTINEVENQILTR 764
                                   750       760

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Four-helical up-and-down bundle (308)

Superfamily: alpha-catenin/vinculin-like (25)

Family: alpha-catenin/vinculin (24)

Protein domain: automated matches (8)

Human (Homo sapiens) [TaxId: 9606] (5)

1a	d1ydia1	A:-4-128
1b	d1ydia2	A:129-258

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Four Helix Bundle (Hemerythrin (Met), subunit A) (300)

Homologous Superfamily: [code=1.20.120.230, no name defined] (23)

Human (Homo sapiens) (11)

1ydiA02

A:130-258

Topology: vbs2 fragment of talin (15)

Homologous Superfamily: vbs2 fragment of talin (15)

Human (Homo sapiens) (7)

1ydiA01

A:-4-129

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Spectrin] (10)

Family: Spectrin (10)

Homo sapiens (Human) (8)

Spectrin-1ydiB01

B:741-759

Clan: no clan defined [family: Vinculin] (16)

Family: Vinculin (16)

Homo sapiens (Human) (8)

Vinculin-1ydiA01

A:3-258

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (VINC_HUMAN | P18206)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0045294	alpha-catenin binding	Interacting selectively and non-covalently with the alpha subunit of the catenin complex.
	GO:0008013	beta-catenin binding	Interacting selectively and non-covalently with the beta subunit of the catenin complex.
	GO:0045296	cadherin binding	Interacting selectively and non-covalently with cadherin, a type I membrane protein involved in cell adhesion.
	GO:0002162	dystroglycan binding	Interacting selectively and non-covalently with dystroglycan. Dystroglycan is glycoprotein found in non-muscle tissues as well as in muscle tissues, often in association with dystrophin. The native dystroglycan cleaved into two non-covalently associated subunits, alpha (N-terminal) and beta (C-terminal).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005198	structural molecule activity	The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
	GO:0031625	ubiquitin protein ligase binding	Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
	GO:0034333	adherens junction assembly	The aggregation, arrangement and bonding together of a set of components to form an adherens junction. An adherens junction is a cell junction at which the cytoplasmic face of the plasma membrane is attached to actin filaments.
	GO:0043297	apical junction assembly	The formation of an apical junction, a functional unit located near the cell apex at the points of contact between epithelial cells composed of the tight junction, the zonula adherens junction and the desmosomes, by the aggregation, arrangement and bonding together of its constituents.
	GO:0048675	axon extension	Long distance growth of a single axon process involved in cellular development.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0007160	cell-matrix adhesion	The binding of a cell to the extracellular matrix via adhesion molecules.
	GO:0090136	epithelial cell-cell adhesion	The attachment of an epithelial cell to another epithelial cell via adhesion molecules.
	GO:0030032	lamellipodium assembly	Formation of a lamellipodium, a thin sheetlike extension of the surface of a migrating cell.
	GO:0002009	morphogenesis of an epithelium	The process in which the anatomical structures of epithelia are generated and organized. An epithelium consists of closely packed cells arranged in one or more layers, that covers the outer surfaces of the body or lines any internal cavity or tube.
	GO:0006928	movement of cell or subcellular component	The directed, self-propelled movement of a cell or subcellular component without the involvement of an external agent such as a transporter or a pore.
	GO:0006936	muscle contraction	A process in which force is generated within muscle tissue, resulting in a change in muscle geometry. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis.
	GO:0030336	negative regulation of cell migration	Any process that stops, prevents, or reduces the frequency, rate or extent of cell migration.
	GO:0070527	platelet aggregation	The adhesion of one platelet to one or more other platelets via adhesion molecules.
	GO:0002576	platelet degranulation	The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
	GO:0034394	protein localization to cell surface	A process in which a protein is transported to, or maintained in, a location within the external part of the cell wall and/or plasma membrane.
	GO:0030334	regulation of cell migration	Any process that modulates the frequency, rate or extent of cell migration.
cellular component
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0005912	adherens junction	A cell junction at which anchoring proteins (cadherins or integrins) extend through the plasma membrane and are attached to actin filaments.
	GO:0005903	brush border	The dense covering of microvilli on the apical surface of a epithelial cells in tissues such as the intestine, kidney, and choroid plexus; the microvilli aid absorption by increasing the surface area of the cell.
	GO:0005623	cell	The basic structural and functional unit of all organisms. Includes the plasma membrane and any external encapsulating structures such as the cell wall and cell envelope.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005913	cell-cell adherens junction	An adherens junction which connects a cell to another cell.
	GO:0005911	cell-cell junction	A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
	GO:0030055	cell-substrate junction	A cell junction that forms a connection between a cell and the extracellular matrix.
	GO:0043034	costamere	Regular periodic sub membranous arrays of vinculin in skeletal and cardiac muscle cells, these arrays link Z-discs to the sarcolemma and are associated with links to extracellular matrix.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:1903561	extracellular vesicle	Any vesicle that is part of the extracellular region.
	GO:0005916	fascia adherens	A cell-cell adherens junction that contains the transmembrane protein N-cadherin, which interacts with identical molecules from neighboring cells to form a tight mechanical intercellular link; forms a large portion of the intercalated disc, the structure at which myofibrils terminate in cardiomyocytes.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0090637	inner dense plaque of desmosome	The desmosomal part containing the C-termini of desmoplakins which interact with the keratin intermediate filaments, serving to tether the intermediate filaments to the plasma membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0045121	membrane raft	Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
	GO:0090636	outer dense plaque of desmosome	The desmosomal part containing plakoglobins, plakophilins, the N-termini of desmoplakins, as well as the cytoplasmic tails of the desmosomal cadherins, which together attach the plaque to the plasma membrane.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:1990357	terminal web	An actin-rich cytoskeletal network located beneath the microvilli of the apical plasma membrane of polarized epithelial cells. In addition to actin filaments, the terminal web may contain actin-binding proteins, myosin motor proteins, and intermediate filaments. The terminal web can function as a contractile structure that influences the spatial distribution of microvilli as well as the development and morphogenesis of tissues containing polarized epithelial cells.
	GO:0005915	zonula adherens	A cell-cell adherens junction which forms a continuous belt near the apex of epithelial cells.

Chain B (ACTN4_HUMAN | O43707)

molecular function
	GO:0000977	RNA polymerase II regulatory region sequence-specific DNA binding	Interacting selectively and non-covalently with a specific sequence of DNA that is part of a regulatory region that controls the transcription of a gene or cistron by RNA polymerase II.
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0051015	actin filament binding	Interacting selectively and non-covalently with an actin filament, also known as F-actin, a helical filamentous polymer of globular G-actin subunits.
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0031490	chromatin DNA binding	Interacting selectively and non-covalently with DNA that is assembled into chromatin.
	GO:0005178	integrin binding	Interacting selectively and non-covalently with an integrin.
	GO:0044325	ion channel binding	Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.
	GO:0030374	ligand-dependent nuclear receptor transcription coactivator activity	The function of a transcription cofactor that activates transcription in conjuction with a ligand-dependent nuclear receptor from a RNA polymerase II promoter; does not bind DNA itself.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0035257	nuclear hormone receptor binding	Interacting selectively and non-covalently with a nuclear hormone receptor, a ligand-dependent receptor found in the nucleus of the cell.
	GO:0001882	nucleoside binding	Interacting selectively and non-covalently with a nucleoside, a compound consisting of a purine or pyrimidine nitrogenous base linked either to ribose or deoxyribose.
	GO:0047485	protein N-terminus binding	Interacting selectively and non-covalently with a protein N-terminus, the end of any peptide chain at which the 2-amino (or 2-imino) function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0042974	retinoic acid receptor binding	Interacting selectively and non-covalently with the retinoic acid receptor, a ligand-regulated transcription factor belonging to the nuclear receptor superfamily.
biological process
	GO:0051017	actin filament bundle assembly	The assembly of actin filament bundles; actin filaments are on the same axis but may be oriented with the same or opposite polarities and may be packed with different levels of tightness.
	GO:0070830	bicellular tight junction assembly	The aggregation, arrangement and bonding together of a set of components to form a tight junction, an occluding cell-cell junction that is composed of a branching network of sealing strands that completely encircles the apical end of each cell in an epithelial sheet.
	GO:0051271	negative regulation of cellular component movement	Any process that stops, prevents, or reduces the frequency, rate or extent of the movement of a cellular component.
	GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	Any process that stops, prevents or reduces the frequency, rate or extent of substrate adhesion-dependent cell spreading.
	GO:0035357	peroxisome proliferator activated receptor signaling pathway	The series of molecular signals initiated by binding of a ligand to any of the peroxisome proliferator activated receptors (alpha, beta or gamma) in the nuclear membrane, and ending with the initiation or termination of the transcription of target genes.
	GO:0002576	platelet degranulation	The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
	GO:1901224	positive regulation of NIK/NF-kappaB signaling	Any process that activates or increases the frequency, rate or extent of NIK/NF-kappaB signaling.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:0051272	positive regulation of cellular component movement	Any process that activates or increases the frequency, rate or extent of the movement of a cellular component.
	GO:0048549	positive regulation of pinocytosis	Any process that activates, maintains or increases the rate of pinocytosis. Pinocytosis is the process in which cells take in liquid material from their external environment; literally 'cell drinking'. Liquid is enclosed in vesicles, formed by invagination of the plasma membrane. These vesicles then move into the cell and pass their contents to endosomes.
	GO:0032417	positive regulation of sodium:proton antiporter activity	Any process that activates or increases the activity of a sodium:hydrogen antiporter, which catalyzes the reaction: Na+(out) + H+(in) = Na+(in) + H+(out).
	GO:1902396	protein localization to bicellular tight junction	A process in which a protein is transported to, or maintained in, a location within a bicellular tight junction.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0042981	regulation of apoptotic process	Any process that modulates the occurrence or rate of cell death by apoptotic process.
	GO:1903506	regulation of nucleic acid-templated transcription	Any process that modulates the frequency, rate or extent of nucleic acid-templated transcription.
	GO:0001666	response to hypoxia	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
	GO:0048384	retinoic acid receptor signaling pathway	The series of molecular signals generated as a consequence of a retinoic acid receptor binding to one of its physiological ligands.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0030050	vesicle transport along actin filament	Movement of a vesicle along an actin filament, mediated by motor proteins.
cellular component
	GO:0030018	Z disc	Platelike region of a muscle sarcomere to which the plus ends of actin filaments are attached.
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0005903	brush border	The dense covering of microvilli on the apical surface of a epithelial cells in tissues such as the intestine, kidney, and choroid plexus; the microvilli aid absorption by increasing the surface area of the cell.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005911	cell-cell junction	A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
	GO:0030863	cortical cytoskeleton	The portion of the cytoskeleton that lies just beneath the plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0043005	neuron projection	A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0031093	platelet alpha granule lumen	The volume enclosed by the membrane of the platelet alpha granule.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0031143	pseudopodium	A temporary protrusion or retractile process of a cell, associated with flowing movements of the protoplasm, and serving for locomotion and feeding.
	GO:0001725	stress fiber	A contractile actin filament bundle that consists of short actin filaments with alternating polarity, cross-linked by alpha-actinin and possibly other actin bundling proteins, and with myosin present in a periodic distribution along the fiber.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ydi)

	Sites
(no "Sites" information available for 1ydi)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ydi)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ydi
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ACTN4_HUMAN \| O43707
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	VINC_HUMAN \| P18206
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	603278
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ACTN4_HUMAN \| O43707
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	VINC_HUMAN \| P18206
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1YDI)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (1, 1)

Exons (7, 7)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (2, 2)

Pfam Domains (2, 2)

Gene Ontology (91, 103)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File