1LLM | PD0312 - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:DNA  Length:13
                                             
                 1llm A   1 TCCCACGCGTGGG  13
                                    10

Chain B from PDB  Type:DNA  Length:13
                                             
                 1llm B  21 TCCCACGCGTGGG  33
                                    30

Chain C from PDB  Type:PROTEIN  Length:87
 aligned with EGR1_MOUSE | P08046 from UniProtKB/Swiss-Prot  Length:533

    Alignment length:169
                                   372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522         
           EGR1_MOUSE   363 QKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVASPAASSLSSYPSPVATSYPSPATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQVSSFPSAGVSSSFSTSTGLSDMTATFSPRTIE 531
               SCOP domains d1llmc1 C:101-128 ZIF268    d1llmc2 C:129-156 ZIF268                                                                              --------------------------------------- SCOP domains
               CATH domains 1llmC01 C:101-130             1llmC02 C:131-187 Classic                                                                           Zinc Finger                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee......ee.hhhhhhhhhhhhhh...ee......ee.hhhhhhhhhhhhh--------------------------------------------------------------------------hhhhhhhhhhhh--------hhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----ZINC_FINGER_C2H2_1   -------ZINC_FINGER_C2H2_1   ------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1llm C 101 MKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHRDIQH--------------------------------------------------------------------------ILPILEDKVEEL--------LSKNYHLENEVARLKKLVGE 187
                                   110       120       130       140       150    |    -         -         -         -         -         -         -       156       166|      168       178         
                                                                                155                                                                        156        167      168

Chain C from PDB  Type:PROTEIN  Length:87
 aligned with GCN4_YEAST | P03069 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:111
                                                                                                            252                            
                                                                                                          251 |                            
                                   180       190       200       210       220       230       240       250| |    259       269       279 
           GCN4_YEAST   171 AKLTQTRKVKKPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAARRSRARKLQRMK-QLEDKVEELLSKNYHLENEVARLKKLVGE 280
               SCOP domains d1llmc1 C:1              01-128 Z  IF268    d     1llmc2 C:129-156    ZIF268    ------------------------------- SCOP domains
               CATH domains 1llmC01 C:1              01-130                    1llmC02 C:131-18   7 Classic Zinc Finger                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee......--------------ee.hhhhh--hhhhhhhhh.-----..ee......ee.hhhh---hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------------------------------BZIP_BASIC     ------------------------------------ PROSITE (1)
                PROSITE (2) ------------------------------------------------------------BZIP  PDB: C:140-183 UniProt: 231-276          ---- PROSITE (2)
               Transcript 1 Exon 1.1  PDB: C:101-187 (gaps) UniProt: 1-281 [INCOMPLETE]                                                     Transcript 1
                 1llm C 101 MKPFQCRICMR--------------NFSRSDHL--TTHIRTHTGE-----KPFACDICGRKFARSDE---RKRHRDIQHILPILEDKVEELLSKNYHLENEVARLKKLVGE 187
                                   110|        -     | 116  |  | 124    |    -|      139      |  -|      156       166       176       186 
                                    111            112    119  |      129   130             146 147                                        
                                                             120

Chain D from PDB  Type:PROTEIN  Length:85
 aligned with EGR1_MOUSE | P08046 from UniProtKB/Swiss-Prot  Length:533

    Alignment length:167
                                   372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       
           EGR1_MOUSE   363 QKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVASPAASSLSSYPSPVATSYPSPATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQVSSFPSAGVSSSFSTSTGLSDMTATFSPRT 529
               SCOP domains d1llmd1 D:201-228 ZIF268    d1llmd2 D:229-256 ZIF268                                                                              ------------------------------------- SCOP domains
               CATH domains 1llmD01 D:201-230             1llmD02 D:231-285 Classic                                                                           Zinc Finger                           CATH domains
           Pfam domains (1) -----------------zf-H2C2_2-1llmD01         ------------------------------------------------------------------------------------------bZIP_1-1--------llmD05 D:260-285   Pfam domains (1)
           Pfam domains (2) -----------------zf-H2C2_2-1llmD02         ------------------------------------------------------------------------------------------bZIP_1-1--------llmD06 D:260-285   Pfam domains (2)
           Pfam domains (3) -----------------zf-H2C2_2-1llmD03         ---------------------------------------------------------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) -----------------zf-H2C2_2-1llmD04         ---------------------------------------------------------------------------------------------------------------------------- Pfam domains (4)
         Sec.struct. author ...ee......ee.hhhhhhhhhhhhhh...ee......ee.hhhhhhhhhhhhh--------------------------------------------------------------------------hhhhhhhhhhhh--------hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -----------E----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----ZINC_FINGER_C2H2_1   -------ZINC_FINGER_C2H2_1   ----------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1llm D 201 MKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHRDIQH--------------------------------------------------------------------------ILPILEDKVEEL--------LSKNYHLENEVARLKKLV 285
                                   210       220       230       240       250    |    -         -         -         -         -         -         -       256       266|      268       278       
                                                                                255                                                                        256        267      268

Chain D from PDB  Type:PROTEIN  Length:85
 aligned with GCN4_YEAST | P03069 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:109
                                                                                                            252                          
                                                                                                          251 |                          
                                   180       190       200       210       220       230       240       250| |    259       269         
           GCN4_YEAST   171 AKLTQTRKVKKPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAARRSRARKLQRMK-QLEDKVEELLSKNYHLENEVARLKKLV 278
               SCOP domains d1llmd1 D:2              01-228 Z  IF268    d     1llmd2 D:229-256    ZIF268    ----------------------------- SCOP domains
               CATH domains 1llmD01 D:2              01-230                    1llmD02 D:231-28   5 Classic Zinc Finger                   CATH domains
           Pfam domains (1) -------------------------------zf---H2C2_2-1l-----lmD01         -------------------bZIP_1-1llmD05 D:260-285   Pfam domains (1)
           Pfam domains (2) -------------------------------zf---H2C2_2-1l-----lmD02         -------------------bZIP_1-1llmD06 D:260-285   Pfam domains (2)
           Pfam domains (3) -------------------------------zf---H2C2_2-1l-----lmD03         --------------------------------------------- Pfam domains (3)
           Pfam domains (4) -------------------------------zf---H2C2_2-1l-----lmD04         --------------------------------------------- Pfam domains (4)
         Sec.struct. author ...ee......--------------ee.hhhhh--hhhhhhhhh.-----..ee......ee.hhhh---hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------E----------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------------------------------BZIP_BASIC     ---------------------------------- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------BZIP  PDB: D:240-283 UniProt: 231-276          -- PROSITE (2)
               Transcript 1 Exon 1.1  PDB: D:201-285 (gaps) UniProt: 1-281 [INCOMPLETE]                                                   Transcript 1
                 1llm D 201 MKPFQCRICMR--------------NFSRSDHL--TTHIRTHTGE-----KPFACDICGRKFARSDE---RKRHRDIQHILPILEDKVEELLSKNYHLENEVARLKKLV 285
                                   210|        -     | 216  |  | 224    |    -|      239      |  -|      256       266       276         
                                    211            212    219  |      229   230             246 247                                      
                                                             220

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit(hide GO term definitions)

Chain C,D (GCN4_YEAST | P03069)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II.
	GO:0000981	RNA polymerase II transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription by RNA polymerase II. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0001135	transcription factor activity, RNA polymerase II transcription factor recruiting	The function of binding to an RNA polymerase II (RNAP II) transcription factor and recruiting it to the transcription machinery complex in order to modulate transcription by RNAP II.
	GO:0001084	transcription factor activity, TFIID-class binding	Interacting selectively and non-covalently with a basal RNA polymerase II transcription factor of the TFIID class in order to modulate transcription. The transcription factor may or may not also interact selectively with DNA as well.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0001190	transcriptional activator activity, RNA polymerase II transcription factor binding	Interacting selectively and non-covalently with an RNA polymerase II transcription factor, which may be a single protein or a complex, in order to increase the frequency, rate or extent of transcription from an RNA polymerase II promoter. A protein binding transcription factor may or may not also interact with the template nucleic acid (either DNA or RNA) as well.
	GO:0001191	transcriptional repressor activity, RNA polymerase II transcription factor binding	Interacting selectively and non-covalently with an RNA polymerase II transcription factor, which may be a single protein or a complex, in order to stop, prevent, or reduce the frequency, rate or extent of transcription from an RNA polymerase II promoter. A protein binding transcription factor may or may not also interact with the template nucleic acid (either DNA or RNA) as well.
biological process
	GO:0008652	cellular amino acid biosynthetic process	The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
	GO:0010691	negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to nutrient levels	Any process that decreases the frequency, rate or extent of the synthesis of RNA from ribosomal protein genes by RNA polymerase II, originating at an RNA polymerase II promoter, as a result of a stimulus reflecting the presence, absence, or concentration of nutrients.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0001080	nitrogen catabolite activation of transcription from RNA polymerase II promoter	A transcription regulation process in which the presence of one nitrogen source leads to an increase in the frequency, rate, or extent of transcription, from an RNA polymerase II promoter, of specific genes involved in the metabolism of other nitrogen sources.
	GO:0045899	positive regulation of RNA polymerase II transcriptional preinitiation complex assembly	Any process that activates or increases the frequency, rate or extent of RNA polymerase II transcriptional preinitiation complex assembly.
	GO:1903833	positive regulation of cellular response to amino acid starvation	Any process that activates or increases the frequency, rate or extent of cellular response to amino acid starvation.
	GO:0060261	positive regulation of transcription initiation from RNA polymerase II promoter	Any process that increases the rate, frequency or extent of a process involved in starting transcription from an RNA polymerase II promoter.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0000790	nuclear chromatin	The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005667	transcription factor complex	A protein complex that is capable of associating with DNA by direct binding, or via other DNA-binding proteins or complexes, and regulating transcription.

Chain C,D (EGR1_MOUSE | P08046)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0000977	RNA polymerase II regulatory region sequence-specific DNA binding	Interacting selectively and non-covalently with a specific sequence of DNA that is part of a regulatory region that controls the transcription of a gene or cistron by RNA polymerase II.
	GO:0035035	histone acetyltransferase binding	Interacting selectively and non-covalently with the enzyme histone acetyltransferase.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0000982	transcription factor activity, RNA polymerase II core promoter proximal region sequence-specific binding	Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to modulate transcription by RNAP II.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0044212	transcription regulatory region DNA binding	Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
	GO:0000976	transcription regulatory region sequence-specific DNA binding	Interacting selectively and non-covalently with a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.
	GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding	Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
biological process
	GO:0030509	BMP signaling pathway	A series of molecular signals initiated by the binding of a member of the BMP (bone morphogenetic protein) family to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0030217	T cell differentiation	The process in which a precursor cell type acquires characteristics of a more mature T-cell. A T cell is a type of lymphocyte whose definin characteristic is the expression of a T cell receptor complex.
	GO:0071480	cellular response to gamma radiation	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gamma radiation stimulus. Gamma radiation is a form of electromagnetic radiation (EMR) or light emission of a specific frequency produced from sub-atomic particle interaction, such as electron-positron annihilation and radioactive decay. Gamma rays are generally characterized as EMR having the highest frequency and energy, and also the shortest wavelength, within the electromagnetic radiation spectrum.
	GO:0071504	cellular response to heparin	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a heparin stimulus.
	GO:0071506	cellular response to mycophenolic acid	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mycophenolic acid stimulus.
	GO:0071310	cellular response to organic substance	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
	GO:0072110	glomerular mesangial cell proliferation	The multiplication or reproduction of glomerular mesangial cells, resulting in the expansion of the population.
	GO:0070498	interleukin-1-mediated signaling pathway	A series of molecular signals initiated by the binding of interleukin-1 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0090090	negative regulation of canonical Wnt signaling pathway	Any process that decreases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0072303	positive regulation of glomerular metanephric mesangial cell proliferation	Any process that increases the frequency, rate or extent of metanephric glomerular mesangial cell proliferation.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0042981	regulation of apoptotic process	Any process that modulates the occurrence or rate of cell death by apoptotic process.
	GO:0033233	regulation of protein sumoylation	Any process that modulates the frequency, rate or extent of the addition of SUMO groups to a protein.
	GO:0061418	regulation of transcription from RNA polymerase II promoter in response to hypoxia	Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of a hypoxia stimulus.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0009749	response to glucose	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucose stimulus.
	GO:0032868	response to insulin	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
	GO:0035914	skeletal muscle cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of a skeletal muscle cell, a somatic cell located in skeletal muscle.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (3, 8)

Exons (1, 2)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (2, 6)

Gene Ontology (53, 61)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File