Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE HEAD-TO-TAIL JUNCTION OF TROPOMYOSIN COMPLEXED WITH A FRAGMENT OF TNT
 
Authors :  K. Murakami, K. Nozawa, K. Tomii, N. Kudou, N. Igarashi, Y. Shirakihara S. Wakatsuki, M. Stewart, T. Yasunaga, T. Wakabayashi
Date :  12 Jul 07  (Deposition) - 22 Apr 08  (Release) - 18 Sep 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.89
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,T
Biol. Unit 1:  A,B,I,T  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,F  (1x)
Biol. Unit 4:  G,H  (1x)
Keywords :  Actin, Troponin, Tropomyosin, Cytoskeleton, Cardiomyopathy, Four- Helix Bundle, Contractile Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Murakami, M. Stewart, K. Nozawa, K. Tomii, N. Kudou, N. Igarashi, Y. Shirakihara, S. Wakatsuki, T. Yasunaga, T. Wakabayashi
Structural Basis For Tropomyosin Overlap In Thin (Actin) Filaments And The Generation Of A Molecular Swivel By Troponin-T
Proc. Natl. Acad. Sci. Usa V. 105 7200 2008
PubMed-ID: 18483193  |  Reference-DOI: 10.1073/PNAS.0801950105

(-) Compounds

Molecule 1 - GENERAL CONTROL PROTEIN GCN4 AND TROPOMYOSIN ALPHA-1 CHAIN
    ChainsA, B, C, D, E, F, G, H
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET3A
    Expression System StrainBL21(DE3)PLYSS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentC TERMINAL DOMAIN OF GCN4 AND TROPOMYOSIN ALPHA-1 CHAIN
    Organism CommonBAKER'S YEAST, RABBIT
    Organism ScientificSACCHAROMYCES CEREVISIAE, ORYCTOLAGUS CUNICULUS
    Organism Taxid4932,9986
    Strain,
    SynonymTM
 
Molecule 2 - TROPOMYOSIN ALPHA-1 CHAIN AND GENERAL CONTROL PROTEIN GCN4
    ChainsI
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET3A
    Expression System StrainBL21(DE3)PLYSS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentN TERMINAL DOMAIN OF TROPOMYOSIN ALPHA-1 CHAIN AND C TERMINAL DOMAIN OF GCN4
    Organism CommonRABBIT, BAKER'S YEAST
    Organism ScientificORYCTOLAGUS CUNICULUS, SACCHAROMYCES CEREVISIAE
    Organism Taxid9986,4932
    Strain,
    SynonymTM
 
Molecule 3 - TROPONIN T, FAST SKELETAL MUSCLE ISOFORMS
    ChainsT
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET3A
    Expression System StrainC41(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentRESIDUES 58-112
    Organism CommonCHICKEN
    Organism ScientificGALLUS GALLUS
    Organism Taxid9031
    SynonymTNT

 Structural Features

(-) Chains, Units

  12345678910
Asymmetric Unit ABCDEFGHIT
Biological Unit 1 (1x)AB      IT
Biological Unit 2 (1x)  CD      
Biological Unit 3 (1x)    EF    
Biological Unit 4 (1x)      GH  

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2Z5H)

(-) Sites  (0, 0)

(no "Site" information available for 2Z5H)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2Z5H)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2Z5H)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 10)

Asymmetric Unit (2, 10)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_GCN4_YEAST_003 *T82AGCN4_YEAST  ---  ---C/GN239A
2UniProtVAR_GCN4_YEAST_006 *D196EGCN4_YEAST  ---  ---A/B/D/E/F/H
C/G
E245
272
E
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
2UniProtVAR_GCN4_YEAST_006 *D196EGCN4_YEAST  ---  ---A/B
C/G
E245
272
E
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_GCN4_YEAST_003 *T82AGCN4_YEAST  ---  ---CN239A
2UniProtVAR_GCN4_YEAST_006 *D196EGCN4_YEAST  ---  ---C/D
C/G
E245
272
E
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
2UniProtVAR_GCN4_YEAST_006 *D196EGCN4_YEAST  ---  ---E/F
C/G
E245
272
E
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (2, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_GCN4_YEAST_003 *T82AGCN4_YEAST  ---  ---GN239A
2UniProtVAR_GCN4_YEAST_006 *D196EGCN4_YEAST  ---  ---G/H
C/G
E245
272
E
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 14)

Asymmetric Unit (2, 14)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BZIPPS50217 Basic-leucine zipper (bZIP) domain profile.GCN4_YEAST231-276
 
 
 
 
 
 
  7A:262-279
B:262-279
D:262-279
E:262-279
F:262-279
H:262-279
I:5-34
2BZIP_BASICPS00036 Basic-leucine zipper (bZIP) domain signature.GCN4_YEAST231-245
 
 
 
 
 
 
  7A:262-262
B:262-262
D:262-262
E:262-262
F:262-262
H:262-262
I:5-5
Biological Unit 1 (2, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BZIPPS50217 Basic-leucine zipper (bZIP) domain profile.GCN4_YEAST231-276
 
 
 
 
 
 
  3A:262-279
B:262-279
-
-
-
-
I:5-34
2BZIP_BASICPS00036 Basic-leucine zipper (bZIP) domain signature.GCN4_YEAST231-245
 
 
 
 
 
 
  3A:262-262
B:262-262
-
-
-
-
I:5-5
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BZIPPS50217 Basic-leucine zipper (bZIP) domain profile.GCN4_YEAST231-276
 
 
 
 
 
 
  1-
-
D:262-279
-
-
-
-
2BZIP_BASICPS00036 Basic-leucine zipper (bZIP) domain signature.GCN4_YEAST231-245
 
 
 
 
 
 
  1-
-
D:262-262
-
-
-
-
Biological Unit 3 (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BZIPPS50217 Basic-leucine zipper (bZIP) domain profile.GCN4_YEAST231-276
 
 
 
 
 
 
  2-
-
-
E:262-279
F:262-279
-
-
2BZIP_BASICPS00036 Basic-leucine zipper (bZIP) domain signature.GCN4_YEAST231-245
 
 
 
 
 
 
  2-
-
-
E:262-262
F:262-262
-
-
Biological Unit 4 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BZIPPS50217 Basic-leucine zipper (bZIP) domain profile.GCN4_YEAST231-276
 
 
 
 
 
 
  1-
-
-
-
-
H:262-279
-
2BZIP_BASICPS00036 Basic-leucine zipper (bZIP) domain signature.GCN4_YEAST231-245
 
 
 
 
 
 
  1-
-
-
-
-
H:262-262
-

(-) Exons   (0, 0)

(no "Exon" information available for 2Z5H)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:49
 aligned with GCN4_YEAST | P03069 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:89
                                   192       202       212       222       232       242       252       262         
           GCN4_YEAST   183 NSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEV 271
               SCOP domains -d2z5ha1 A :234-281 T                 ropomy  osi            n                            SCOP domains
               CATH domains 2z5hA00 A: 233-281                                                                        CATH domains
               Pfam domains ----------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh-hhhhhhhhhh-----------------hhhhhh--hhh------------hhhhh-hhhhhhhhhhhh-------... Sec.struct. author
                 SAPs(SNPs) -------------E--------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------------------BZIP  PDB: A:262-279 UniProt: 231-276     PROSITE (1)
                PROSITE (2) ------------------------------------------------BZIP_BASIC     -------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------- Transcript
                 2z5h A 233 GELLSKNYHL-ENEVARLKKL-----------------VDDLED--ELY------------AQKLK-YKAISEELDHAL-------NDM 281
                                   242 |     251|        -       254   |  | |-         - |   | 269        |-      |  
                                   242 |      252               253  258  | |          262 266 |        278     279  
                                     243                                259 |                267                     
                                                                          261                                        

Chain A from PDB  Type:PROTEIN  Length:49
 aligned with TPM1_RABIT | P58772 from UniProtKB/Swiss-Prot  Length:284

    Alignment length:94
                                   197       207       217       227       237       247       257       267       277    
           TPM1_RABIT   188 GKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDM 281
               SCOP domains --------------------d2z5ha1                           A:234-281 Tropomyosin                    SCOP domains
               CATH domains 2                   z5hA00 A                          :233-281                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author h-------------------hhhhhhhh--------------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------E------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------- Transcript
                 2z5h A 233 G-------------------ELLSKNYH--------------------------LENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDM 281
                            |        -         -|      | -         -         -    |  247       257       267       277    
                          233                 234    241                        242                                       

Chain B from PDB  Type:PROTEIN  Length:51
 aligned with GCN4_YEAST | P03069 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:91
                                   192       202       212       222       232       242       252       262       272 
           GCN4_YEAST   183 NSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVAR 273
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2z5hB00 B: 233-283                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh-hhhhhhhhhh-----------------hhhhhh--hhh------------hhhhh-hhhhhhhhhhhh-------hh... Sec.struct. author
                 SAPs(SNPs) -------------E----------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------------------BZIP  PDB: B:262-279 UniProt: 231-276       PROSITE (1)
                PROSITE (2) ------------------------------------------------BZIP_BASIC     ---------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 2z5h B 233 GELLSKNYHL-ENEVARLKKL-----------------VDDLED--ELY------------AQKLK-YKAISEELDHAL-------NDMTS 283
                                   242 |     251|        -       254   |  | |-         - |   | 269        |-      |282 
                                   242 |      252               253  258  | |          262 266 |        278     279    
                                     243                                259 |                267                       
                                                                          261                                          

Chain B from PDB  Type:PROTEIN  Length:51
 aligned with TPM1_RABIT | P58772 from UniProtKB/Swiss-Prot  Length:284

    Alignment length:96
                                   197       207       217       227       237       247       257       267       277      
           TPM1_RABIT   188 GKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTS 283
               SCOP domains ------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2                   z5hB00 B                          :233-283                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author h-------------------hhhhhhhh--------------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------E-------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------ Transcript
                 2z5h B 233 G-------------------ELLSKNYH--------------------------LENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDMTS 283
                            |        -         -|      | -         -         -    |  247       257       267       277      
                          233                 234    241                        242                                         

Chain C from PDB  Type:PROTEIN  Length:52
 aligned with GCN4_YEAST | P03069 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:175
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210     
           GCN4_YEAST    41 GQLIFDKFIKTEEDPIIKQDTPSNLDFDFALPQTATAPDAKTVLPIPELDDAVVESFFSSSTDSTPMFEYENLEDNSKEWTSLFDNDIPVTTDDVSLADKAIESTEEVSLVPSNLEVSTTSFLPTPVLEDAKLTQTRKVKKPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSI 215
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2z5h                                   C00                            C :23                  3-284                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhh-----------------------------------hhh---------------------------hh-hhh------------------hhhhhhhhhhh-----------------------hhhhhhhhhhhhhhhh------------hh--hhh----hhh-hh... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------A------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2z5h C 233 GELL-----------------------------------SKN---------------------------YH-LEN------------------EVARLKKLVDD-----------------------LEDELYAQKLKYKAIS------------EE--LDH----ALN-DMTSI 284
                               |     -         -         -       237 |       -         -       240| | |    -         -   |   251   |     -         -       258       268  |      -     ||274 |    | |-|    
                             236                                 237 |                         240| | |                245       255                     256            271          272|  | |  277 | |    
                                                                   239                          241 | |                                                                               273  | |    279 |    
                                                                                                  242 |                                                                                  274 |      280    
                                                                                                    244                                                                                    276             

Chain C from PDB  Type:PROTEIN  Length:52
 aligned with TPM1_RABIT | P58772 from UniProtKB/Swiss-Prot  Length:284

    Alignment length:97
                                   197       207       217       227       237       247       257       267       277       
           TPM1_RABIT   188 GKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284
               SCOP domains ------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2                   z5hC00 C                          :233-284                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .-------------------hhhhhhhh--------------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------A----------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------- Transcript
                 2z5h C 233 G-------------------ELLSKNYH--------------------------LENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDMTSI 284
                            |        -         -|      | -         -         -    |  247       257       267       277       
                          233                 234    241                        242                                          

Chain D from PDB  Type:PROTEIN  Length:49
 aligned with GCN4_YEAST | P03069 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:89
                                   192       202       212       222       232       242       252       262         
           GCN4_YEAST   183 NSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEV 271
               SCOP domains ----------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2z5hD00 D: 233-281                                                                        CATH domains
               Pfam domains ----------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh-hhhhhhhhhh-----------------hhhhhh--hhh------------hhhhh-hhhhhhhhhhhh-------h.. Sec.struct. author
                 SAPs(SNPs) -------------E--------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------------------BZIP  PDB: D:262-279 UniProt: 231-276     PROSITE (1)
                PROSITE (2) ------------------------------------------------BZIP_BASIC     -------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------- Transcript
                 2z5h D 233 GELLSKNYHL-ENEVARLKKL-----------------VDDLED--ELY------------AQKLK-YKAISEELDHAL-------NDM 281
                                   242 |     251|        -       254   |  | |-         - |   | 269        |-      |  
                                   242 |      252               253  258  | |          262 266 |        278     279  
                                     243                                259 |                267                     
                                                                          261                                        

Chain D from PDB  Type:PROTEIN  Length:49
 aligned with TPM1_RABIT | P58772 from UniProtKB/Swiss-Prot  Length:284

    Alignment length:94
                                   197       207       217       227       237       247       257       267       277    
           TPM1_RABIT   188 GKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDM 281
               SCOP domains ---------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2                   z5hD00 D                          :233-281                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author h-------------------hhhhhhhh--------------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------E------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------- Transcript
                 2z5h D 233 G-------------------ELLSKNYH--------------------------LENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDM 281
                            |        -         -|      | -         -         -    |  247       257       267       277    
                          233                 234    241                        242                                       

Chain E from PDB  Type:PROTEIN  Length:49
 aligned with GCN4_YEAST | P03069 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:89
                                   192       202       212       222       232       242       252       262         
           GCN4_YEAST   183 NSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEV 271
               SCOP domains ----------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2z5hE00 E: 233-281                                                                        CATH domains
               Pfam domains ----------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh-hhhhhhhhhh-----------------hhhhhh--hhh------------hhhhh-hhhhhhhhhhhh-------... Sec.struct. author
                 SAPs(SNPs) -------------E--------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------------------BZIP  PDB: E:262-279 UniProt: 231-276     PROSITE (1)
                PROSITE (2) ------------------------------------------------BZIP_BASIC     -------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------- Transcript
                 2z5h E 233 GELLSKNYHL-ENEVARLKKL-----------------VDDLED--ELY------------AQKLK-YKAISEELDHAL-------NDM 281
                                   242 |     251|        -       254   |  | |-         - |   | 269        |-      |  
                                   242 |      252               253  258  | |          262 266 |        278     279  
                                     243                                259 |                267                     
                                                                          261                                        

Chain E from PDB  Type:PROTEIN  Length:49
 aligned with TPM1_RABIT | P58772 from UniProtKB/Swiss-Prot  Length:284

    Alignment length:94
                                   197       207       217       227       237       247       257       267       277    
           TPM1_RABIT   188 GKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDM 281
               SCOP domains ---------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2                   z5hE00 E                          :233-281                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author h-------------------hhhhhhhh--------------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------E------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------- Transcript
                 2z5h E 233 G-------------------ELLSKNYH--------------------------LENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDM 281
                            |        -         -|      | -         -         -    |  247       257       267       277    
                          233                 234    241                        242                                       

Chain F from PDB  Type:PROTEIN  Length:51
 aligned with GCN4_YEAST | P03069 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:91
                                   192       202       212       222       232       242       252       262       272 
           GCN4_YEAST   183 NSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVAR 273
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2z5hF00 F: 233-283                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh-hhhhhhhhhh-----------------hhhhhh--hhh------------hhhhh-hhhhhhhhhhhh-------hhhhh Sec.struct. author
                 SAPs(SNPs) -------------E----------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------------------BZIP  PDB: F:262-279 UniProt: 231-276       PROSITE (1)
                PROSITE (2) ------------------------------------------------BZIP_BASIC     ---------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 2z5h F 233 GELLSKNYHL-ENEVARLKKL-----------------VDDLED--ELY------------AQKLK-YKAISEELDHAL-------NDMTS 283
                                   242 |     251|        -       254   |  | |-         - |   | 269        |-      |282 
                                   242 |      252               253  258  | |          262 266 |        278     279    
                                     243                                259 |                267                       
                                                                          261                                          

Chain F from PDB  Type:PROTEIN  Length:51
 aligned with TPM1_RABIT | P58772 from UniProtKB/Swiss-Prot  Length:284

    Alignment length:96
                                   197       207       217       227       237       247       257       267       277      
           TPM1_RABIT   188 GKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTS 283
               SCOP domains ------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2                   z5hF00 F                          :233-283                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author h-------------------hhhhhhhh--------------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------E-------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------ Transcript
                 2z5h F 233 G-------------------ELLSKNYH--------------------------LENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDMTS 283
                            |        -         -|      | -         -         -    |  247       257       267       277      
                          233                 234    241                        242                                         

Chain G from PDB  Type:PROTEIN  Length:52
 aligned with GCN4_YEAST | P03069 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:175
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210     
           GCN4_YEAST    41 GQLIFDKFIKTEEDPIIKQDTPSNLDFDFALPQTATAPDAKTVLPIPELDDAVVESFFSSSTDSTPMFEYENLEDNSKEWTSLFDNDIPVTTDDVSLADKAIESTEEVSLVPSNLEVSTTSFLPTPVLEDAKLTQTRKVKKPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSI 215
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2z5h                                   G00                            G :23                  3-284                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhh-----------------------------------hhh---------------------------hh-hhh------------------hhhhhhhhhhh-----------------------hhhhhhhhhhhhhhhh------------hh--hhh----hhh-hh... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------A------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2z5h G 233 GELL-----------------------------------SKN---------------------------YH-LEN------------------EVARLKKLVDD-----------------------LEDELYAQKLKYKAIS------------EE--LDH----ALN-DMTSI 284
                               |     -         -         -       237 |       -         -       240| | |    -         -   |   251   |     -         -       258       268  |      -     ||274 |    | |-|    
                             236                                 237 |                         240| | |                245       255                     256            271          272|  | |  277 | |    
                                                                   239                          241 | |                                                                               273  | |    279 |    
                                                                                                  242 |                                                                                  274 |      280    
                                                                                                    244                                                                                    276             

Chain G from PDB  Type:PROTEIN  Length:52
 aligned with TPM1_RABIT | P58772 from UniProtKB/Swiss-Prot  Length:284

    Alignment length:97
                                   197       207       217       227       237       247       257       267       277       
           TPM1_RABIT   188 GKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284
               SCOP domains ------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2                   z5hG00 G                          :233-284                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .-------------------hhhhhhhh--------------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------A----------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------- Transcript
                 2z5h G 233 G-------------------ELLSKNYH--------------------------LENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDMTSI 284
                            |        -         -|      | -         -         -    |  247       257       267       277       
                          233                 234    241                        242                                          

Chain H from PDB  Type:PROTEIN  Length:49
 aligned with GCN4_YEAST | P03069 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:89
                                   192       202       212       222       232       242       252       262         
           GCN4_YEAST   183 NSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEV 271
               SCOP domains ----------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2z5hH00 H: 233-281                                                                        CATH domains
           Pfam domains (1) ---------------------------------------Tropo--myo------------sin-2-z5hH01      -------    Pfam domains (1)
           Pfam domains (2) ---------------------------------------Tropo--myo------------sin-2-z5hH02      -------    Pfam domains (2)
           Pfam domains (3) ---------------------------------------Tropo--myo------------sin-2-z5hH03      -------    Pfam domains (3)
           Pfam domains (4) ---------------------------------------Tropo--myo------------sin-2-z5hH04      -------    Pfam domains (4)
           Pfam domains (5) ---------------------------------------Tropo--myo------------sin-2-z5hH05      -------    Pfam domains (5)
           Pfam domains (6) ---------------------------------------Tropo--myo------------sin-2-z5hH06      -------    Pfam domains (6)
           Pfam domains (7) ---------------------------------------Tropo--myo------------sin-2-z5hH07      -------    Pfam domains (7)
           Pfam domains (8) ---------------------------------------Tropo--myo------------sin-2-z5hH08      -------    Pfam domains (8)
         Sec.struct. author hhhhhhhhhh-hhhhhhhhhh-----------------hhhhhh--hhh------------hhhhh-hhhhhhhhhhhh-------h.. Sec.struct. author
                 SAPs(SNPs) -------------E--------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------------------BZIP  PDB: H:262-279 UniProt: 231-276     PROSITE (1)
                PROSITE (2) ------------------------------------------------BZIP_BASIC     -------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------- Transcript
                 2z5h H 233 GELLSKNYHL-ENEVARLKKL-----------------VDDLED--ELY------------AQKLK-YKAISEELDHAL-------NDM 281
                                   242 |     251|        -       254   |  | |-         - |   | 269        |-      |  
                                   242 |      252               253  258  | |          262 266 |        278     279  
                                     243                                259 |                267                     
                                                                          261                                        

Chain H from PDB  Type:PROTEIN  Length:49
 aligned with TPM1_RABIT | P58772 from UniProtKB/Swiss-Prot  Length:284

    Alignment length:94
                                   197       207       217       227       237       247       257       267       277    
           TPM1_RABIT   188 GKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDM 281
               SCOP domains ---------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2                   z5hH00 H                          :233-281                                 CATH domains
           Pfam domains (1) ------------------------------------------------------------------Tropomyosin-2z5hH01          Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------Tropomyosin-2z5hH02          Pfam domains (2)
           Pfam domains (3) ------------------------------------------------------------------Tropomyosin-2z5hH03          Pfam domains (3)
           Pfam domains (4) ------------------------------------------------------------------Tropomyosin-2z5hH04          Pfam domains (4)
           Pfam domains (5) ------------------------------------------------------------------Tropomyosin-2z5hH05          Pfam domains (5)
           Pfam domains (6) ------------------------------------------------------------------Tropomyosin-2z5hH06          Pfam domains (6)
           Pfam domains (7) ------------------------------------------------------------------Tropomyosin-2z5hH07          Pfam domains (7)
           Pfam domains (8) ------------------------------------------------------------------Tropomyosin-2z5hH08          Pfam domains (8)
         Sec.struct. author h-------------------hhhhhhhh--------------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------E------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------- Transcript
                 2z5h H 233 G-------------------ELLSKNYH--------------------------LENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDM 281
                            |        -         -|      | -         -         -    |  247       257       267       277    
                          233                 234    241                        242                                       

Chain I from PDB  Type:PROTEIN  Length:39
 aligned with GCN4_YEAST | P03069 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:85
                                   202       212       222       232       242       252       262       272     
           GCN4_YEAST   193 GKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKL 277
               SCOP domains ------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --------------------------------------------------------------------------bZIP_1-2z5h Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------bZIP_1-2z5h Pfam domains (2)
           Pfam domains (3) --------------------------------------------------------------------------bZIP_1-2z5h Pfam domains (3)
           Pfam domains (4) --------------------------------------------------------------------------bZIP_1-2z5h Pfam domains (4)
           Pfam domains (5) --------------------------------------------------------------------------bZIP_1-2z5h Pfam domains (5)
           Pfam domains (6) --------------------------------------------------------------------------bZIP_1-2z5h Pfam domains (6)
           Pfam domains (7) --------------------------------------------------------------------------bZIP_1-2z5h Pfam domains (7)
           Pfam domains (8) --------------------------------------------------------------------------bZIP_1-2z5h Pfam domains (8)
           Pfam domains (9) --------------------------------------------------------------------------bZIP_1-2z5h Pfam domains (9)
         Sec.struct. author .----------------------------....h--hhh-------------hh..-.....h--hhhhh............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------------------------------BZIP  PDB: I:5-34 UniProt: 231-276            - PROSITE (1)
                PROSITE (2) --------------------------------------BZIP_BASIC     -------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 2z5h I  -3 G----------------------------AASMD--AIK-------------KKMQ-MLKLDK--ENALDRAEQLENEVARLKKL  35
                            |        -         -        -2   |  | |-         -  |  | |12  |  |  20        30     
                           -3                           -2   2  3 5             6  9 |   15 16                   
                                                                                    10                           

Chain I from PDB  Type:PROTEIN  Length:39
 aligned with TPM1_RABIT | P58772 from UniProtKB/Swiss-Prot  Length:284

    Alignment length:54
                                1                                                 
                                |    6        16        26        36        46    
           TPM1_RABIT     - ----MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKL  50
               SCOP domains ------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------ CATH domains
           Pfam domains (1) ------------------------------------------bZIP_1-2-z5h Pfam domains (1)
           Pfam domains (2) ------------------------------------------bZIP_1-2-z5h Pfam domains (2)
           Pfam domains (3) ------------------------------------------bZIP_1-2-z5h Pfam domains (3)
           Pfam domains (4) ------------------------------------------bZIP_1-2-z5h Pfam domains (4)
           Pfam domains (5) ------------------------------------------bZIP_1-2-z5h Pfam domains (5)
           Pfam domains (6) ------------------------------------------bZIP_1-2-z5h Pfam domains (6)
           Pfam domains (7) ------------------------------------------bZIP_1-2-z5h Pfam domains (7)
           Pfam domains (8) ------------------------------------------bZIP_1-2-z5h Pfam domains (8)
           Pfam domains (9) ------------------------------------------bZIP_1-2-z5h Pfam domains (9)
         Sec.struct. author .....hhhhhh.......hhhhhh....--------------........-... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------ Transcript
                 2z5h I  -3 GAASMDAIKKKMQMLKLDKENALDRAEQ--------------LENEVARL-KKL  35
                                     6        16       | -         -  |     32 |  
                                                      24             25     32 |  
                                                                              33  

Chain T from PDB  Type:PROTEIN  Length:34
 aligned with TNNT3_CHICK | P12620 from UniProtKB/Swiss-Prot  Length:263

    Alignment length:34
                                    75        85        95    
          TNNT3_CHICK    66 IQKKRQNKDLIELQALIDSHFEARRKEEEELVAL  99
               SCOP domains ---------------------------------- SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---Troponin-2z5hT01 T:69-99        Pfam domains
         Sec.struct. author .......hhhhhh..................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------- PROSITE
                 Transcript ---------------------------------- Transcript
                 2z5h T  66 IQKKRQNKDLIELQALIDSHFEARRKEEEELVAL  99
                                    75        85        95    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (1, 8)

Asymmetric Unit

(-) Pfam Domains  (3, 18)

Asymmetric Unit
(-)
Clan: bZIP (54)

(-) Gene Ontology  (31, 31)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G,H,I   (TPM1_RABIT | P58772)
molecular function
    GO:0003779    actin binding    Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.

Chain A,B,C,D,E,F,G,H,I   (GCN4_YEAST | P03069)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0000978    RNA polymerase II core promoter proximal region sequence-specific DNA binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II.
    GO:0000981    RNA polymerase II transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription by RNA polymerase II. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0003682    chromatin binding    Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
    GO:0001135    transcription factor activity, RNA polymerase II transcription factor recruiting    The function of binding to an RNA polymerase II (RNAP II) transcription factor and recruiting it to the transcription machinery complex in order to modulate transcription by RNAP II.
    GO:0001084    transcription factor activity, TFIID-class binding    Interacting selectively and non-covalently with a basal RNA polymerase II transcription factor of the TFIID class in order to modulate transcription. The transcription factor may or may not also interact selectively with DNA as well.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0001190    transcriptional activator activity, RNA polymerase II transcription factor binding    Interacting selectively and non-covalently with an RNA polymerase II transcription factor, which may be a single protein or a complex, in order to increase the frequency, rate or extent of transcription from an RNA polymerase II promoter. A protein binding transcription factor may or may not also interact with the template nucleic acid (either DNA or RNA) as well.
    GO:0001191    transcriptional repressor activity, RNA polymerase II transcription factor binding    Interacting selectively and non-covalently with an RNA polymerase II transcription factor, which may be a single protein or a complex, in order to stop, prevent, or reduce the frequency, rate or extent of transcription from an RNA polymerase II promoter. A protein binding transcription factor may or may not also interact with the template nucleic acid (either DNA or RNA) as well.
biological process
    GO:0008652    cellular amino acid biosynthetic process    The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
    GO:0010691    negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to nutrient levels    Any process that decreases the frequency, rate or extent of the synthesis of RNA from ribosomal protein genes by RNA polymerase II, originating at an RNA polymerase II promoter, as a result of a stimulus reflecting the presence, absence, or concentration of nutrients.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0001080    nitrogen catabolite activation of transcription from RNA polymerase II promoter    A transcription regulation process in which the presence of one nitrogen source leads to an increase in the frequency, rate, or extent of transcription, from an RNA polymerase II promoter, of specific genes involved in the metabolism of other nitrogen sources.
    GO:0045899    positive regulation of RNA polymerase II transcriptional preinitiation complex assembly    Any process that activates or increases the frequency, rate or extent of RNA polymerase II transcriptional preinitiation complex assembly.
    GO:1903833    positive regulation of cellular response to amino acid starvation    Any process that activates or increases the frequency, rate or extent of cellular response to amino acid starvation.
    GO:0060261    positive regulation of transcription initiation from RNA polymerase II promoter    Any process that increases the rate, frequency or extent of a process involved in starting transcription from an RNA polymerase II promoter.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006366    transcription from RNA polymerase II promoter    The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0000790    nuclear chromatin    The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005667    transcription factor complex    A protein complex that is capable of associating with DNA by direct binding, or via other DNA-binding proteins or complexes, and regulating transcription.

Chain T   (TNNT3_CHICK | P12620)
biological process
    GO:0006937    regulation of muscle contraction    Any process that modulates the frequency, rate or extent of muscle contraction.
    GO:0006942    regulation of striated muscle contraction    Any process that modulates the frequency, rate or extent of striated muscle contraction.
cellular component
    GO:0005861    troponin complex    A complex of accessory proteins (typically troponin T, troponin I and troponin C) found associated with actin in muscle thin filaments; involved in calcium regulation of muscle contraction.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2z5h)
 
  Sites
(no "Sites" information available for 2z5h)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2z5h)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2z5h
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GCN4_YEAST | P03069
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  TNNT3_CHICK | P12620
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  TPM1_RABIT | P58772
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GCN4_YEAST | P03069
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TNNT3_CHICK | P12620
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TPM1_RABIT | P58772
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GCN4_YEAST | P030691ce9 1dgc 1env 1fav 1fmh 1gcl 1gcm 1gk6 1gzl 1ihq 1ij0 1ij1 1ij2 1ij3 1kql 1ld4 1llm 1nkn 1piq 1rb4 1rb5 1rb6 1swi 1tmz 1unt 1unu 1unv 1unw 1unx 1uny 1unz 1uo0 1uo1 1uo2 1uo3 1uo4 1uo5 1w5g 1w5h 1w5i 1w5j 1w5k 1w5l 1ysa 1zii 1zij 1zik 1zil 1zim 1zta 2ahp 2b1f 2b22 2bni 2cce 2ccf 2ccn 2d3e 2dgc 2efr 2efs 2g9j 2hy6 2ipz 2k8x 2lpb 2n9b 2nrn 2o7h 2ovn 2vky 2vnl 2wg5 2wg6 2wpy 2wpz 2wq0 2wq1 2wq2 2wq3 2yny 2ynz 2yo0 2yo1 2yo2 2yo3 2z5i 2zta 3azd 3bas 3bat 3ck4 3crp 3g9r 3gjp 3i1g 3i5c 3k7z 3m48 3p8m 3zmf 4c46 4dmd 4g2k 4hu5 4hu6 4niz 4nj0 4nj1 4nj2 4owi 4tl1 5app 5apq 5aps 5apt 5apu 5apv 5apw 5apx 5apy 5apz 5iew 5iir 5iiv 5kht
        TNNT3_CHICK | P126201ytz 1yv0 2w49 2w4u
        TPM1_RABIT | P587722d3e 2efr 2efs 2tma 2w49 2w4u 2z5i 4a7f 4a7h 4a7l

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2Z5H)