1BIL - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTALLOGRAPHIC STUDIES ON THE BINDING MODES OF P2-P3 BUTANEDIAMIDE RENIN INHIBITORS

Authors :   L. Tong

Date :   27 Sep 95 (Deposition) - 29 Jan 96 (Release) - 18 Jan 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym./Biol. Unit : A,B

Keywords :   Aspartic Proteinase, Aspartyl Protease, Cleavage On Pair Of Basic Residues, Disease Mutation, Disulfide Bond, Glycoprotein, Hydrolase, Membrane, Protease, Secreted, Zymogen, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. Tong, S. Pav, D. Lamarre, B. Simoneau, P. Lavallee, G. Jung
Crystallographic Studies On The Binding Modes Of P2-P3 Butanediamide Renin Inhibitors.
J. Biol. Chem. V. 270 29520 1995
PubMed-ID: 7493993 | Reference-DOI: 10.1074/JBC.270.49.29520

Molecule 1 - RENIN
	Chains	:	A, B
	EC Number	:	3.4.23.15
	Engineered	:	YES
	Expression System	:	STABLY TRANSFERRED DOG EPITHELIAL CELL
	Expression System Gene	:	CMV IE-HUMAN PREPRORENIN CDNA
	Expression System Plasmid	:	PMNC RETROVIRAL VECTOR
	Gene	:	CMV IE-HUMAN PREPRORENIN CDNA, REN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	GLYCOSYLATED
	Synonym	:	ANGIOTENSINOGENASE

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 2)

No.	Name	Count	Type	Full Name
1	0IU	2	Ligand/Ion	(2S)-2-[(2-AMINO-1,3-THIAZOL-4-YL)METHYL]-N~1~-[(1S,2R,3R)-1-(CYCLOHEXYLMETHYL)-2,3-DIHYDROXY-5-METHYLHEXYL]-N~4~-[2-(DIMETHYLAMINO)-2-OXOETHYL]-N~4~-[(1S)-1-PHENYLETHYL]BUTANEDIAMIDE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:32 , GLY A:34 , TYR A:75 , SER A:76 , THR A:77 , PRO A:111 , PHE A:117 , ASP A:215 , GLY A:217 , ALA A:218 , SER A:219 , TYR A:220 , SER A:222 , HIS A:287 , MET A:289 , ALA A:300 , HOH A:803 , HOH A:879	BINDING SITE FOR RESIDUE 0IU A 391
2	AC2	SOFTWARE	ASP B:32 , GLY B:34 , TYR B:75 , SER B:76 , THR B:77 , PRO B:111 , PHE B:117 , ASP B:215 , GLY B:217 , ALA B:218 , SER B:219 , TYR B:220 , SER B:222 , ILE B:291 , HOH B:887	BINDING SITE FOR RESIDUE 0IU B 391

Asymmetric/Biological Unit

No.	Residues
1	A:45	-	A:50
2	A:206	-	A:210
3	A:249	-	A:282
4	B:45	-	B:50
5	B:206	-	B:210
6	B:249	-	B:282

Asymmetric/Biological Unit

No.	Residues
1	Thr A:22	-	Pro A:23
2	Leu A:110	-	Pro A:111
3	Pro A:293	-	Pro A:294
4	Gly A:296	-	Pro A:297
5	Thr B:22	-	Pro B:23
6	Leu B:110	-	Pro B:111
7	Pro B:293	-	Pro B:294
8	Gly B:296	-	Pro B:297

Asymmetric/Biological Unit (4, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035088	D	104	N	RENI_HUMAN	Disease (RTD)	868694193	A/B	D	32	N
2	UniProt	VAR_029171	Q	160	K	RENI_HUMAN	Polymorphism	11571083	A/B	Q	86	K
3	UniProt	VAR_020376	G	217	R	RENI_HUMAN	Polymorphism	11571117	A/B	G	144	R
4	UniProt	VAR_035087	R	230	K	RENI_HUMAN	Disease (RTD)	121917742	A/B	R	157	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PEPTIDASE_A1	PS51767	Peptidase family A1 domain profile.	RENI_HUMAN	86-403	2	A:14-323 B:14-323
2	ASP_PROTEASE	PS00141	Eukaryotic and viral aspartyl proteases active site.	RENI_HUMAN	101-112 289-300	4	A:29-40 B:29-40 A:212-223 B:212-223

Asymmetric/Biological Unit (9, 18)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000272190	1b	ENSE00001952423	chr1:204135450-204135324	127	RENI_HUMAN	1-33	33	0	-	-
1.2	ENST00000272190	2	ENSE00000962217	chr1:204131291-204131141	151	RENI_HUMAN	33-83	51	2	A:-2-11 B:-2-11	14 14
1.3	ENST00000272190	3	ENSE00000962218	chr1:204130543-204130420	124	RENI_HUMAN	84-125	42	2	A:12-51 B:12-51	42 42
1.4	ENST00000272190	4	ENSE00001075102	chr1:204129806-204129688	119	RENI_HUMAN	125-164	40	2	A:51-90 B:51-90	40 40
1.5	ENST00000272190	5	ENSE00001075100	chr1:204128723-204128527	197	RENI_HUMAN	165-230	66	2	A:91-157 (gaps) B:91-157 (gaps)	67 67
1.6	ENST00000272190	6	ENSE00001652153	chr1:204126497-204126489	9	RENI_HUMAN	230-233	4	2	A:157-160 B:157-159	4 3
1.7	ENST00000272190	7	ENSE00000962221	chr1:204125924-204125805	120	RENI_HUMAN	233-273	41	2	A:160-196 (gaps) B:160D-196	41 37
1.8	ENST00000272190	8	ENSE00001306111	chr1:204125447-204125306	142	RENI_HUMAN	273-320	48	2	A:196-244 (gaps) B:196-244 (gaps)	49 49
1.9	ENST00000272190	9	ENSE00000962223	chr1:204125046-204124948	99	RENI_HUMAN	321-353	33	2	A:245-277 B:245-277	33 33
1.10a	ENST00000272190	10a	ENSE00001947658	chr1:204124305-204123947	359	RENI_HUMAN	354-406	53	2	A:278-326 B:278-326	53 53

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:334
 aligned with RENI_HUMAN | P00797 from UniProtKB/Swiss-Prot  Length:406

    Alignment length:337
                                    79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       
          RENI_HUMAN     70 GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR  406
               SCOP domains d1bila_ A: Chymosin (synonym: renin)                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains ---1bilA01 A:1-170 Acid Proteases                                                                                                                                                 1bilA02 A:171-325 Acid Proteases                                                                                                                              - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.eee...eeeeeeee....eeeeeeee......eee........hhh.......hhh.........eeeeee..eeeeeeeeeeeeee..eeeeeeeeeeeee.hhhhhh....eeee...hhh.hhh...hhhhhhhh......eeeeee.....---...eeeee............eeee.......eeee..eee..........eeeee......eee.hhhhhhhhhhh.........eee...hhh...eeeee..eeeee.hhhh..........eee..eee..........eee.hhhh..eeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------N-------------------------------------------------------K--------------------------------------------------------R------------K-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------PEPTIDASE_A1  PDB: A:14-323 UniProt: 86-403                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) -------------------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE---------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2      Exon 1.3  PDB: A:12-51 UniProt: 84-125    ---------------------------------------Exon 1.5  PDB: A:91-157 (gaps) UniProt: 165-230                   --Exon 1.7  PDB: A:160-196 (gaps)          -----------------------------------------------Exon 1.9  PDB: A:245-277         Exon 1.10a  PDB: A:278-326 UniProt: 354-406           Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------Exon 1.4  PDB: A:51-90 UniProt: 125-164 -----------------------------------------------------------------1.6 ---------------------------------------Exon 1.8  PDB: A:196-244 (gaps) UniProt: 273-320-------------------------------------------------------------------------------------- Transcript 1 (2)
                1bil A   -2 GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSE---SLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR  326
                                     7        17        27        37       46A|       55        65        75        85        95 ||    106       116       126       136       146       156   |   162       172       182       192       202       212       222       232       243       253       263       273      279D       289       299       309       319       
                                                                           46A|                                                 97|                                                          160   |                                                                             240|                                  279A|||                                               
                                                                            46B                                                  99                                                             160D                                                                              242                                   279B||                                               
                                                                                                                                                                                                                                                                                                                         279C|                                               
                                                                                                                                                                                                                                                                                                                          279D

Chain B from PDB  Type:PROTEIN  Length:333
 aligned with RENI_HUMAN | P00797 from UniProtKB/Swiss-Prot  Length:406

    Alignment length:337
                                    79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       
          RENI_HUMAN     70 GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR  406
               SCOP domains d1bilb_ B: Chymosin (synonym: renin)                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains ---1bilB01 B:1-170 Acid Proteases                                                                                                                                                 1bilB02 B:171-325 Acid Proteases                                                                                                                              - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeee...eeeeeeee....eeeeeeee......eee........hhhhh.....hhh........eeeeee....eeeeeeeeeeeee..eeeeeeeeeeeee.hhhhhh....eeee...hhh.......hhhhhhhh......eeeeee....----...eeeee............eeee.......eeee..eee..eeee....eeeee......eee.hhhhhhhhhhh..eee..eeeeehhhhhh...eeeee..eeeee.hhhh..........eee..eee..........eee.hhhh..eeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------N-------------------------------------------------------K--------------------------------------------------------R------------K-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------PEPTIDASE_A1  PDB: B:14-323 UniProt: 86-403                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) -------------------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE---------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2      Exon 1.3  PDB: B:12-51 UniProt: 84-125    ---------------------------------------Exon 1.5  PDB: B:91-157 (gaps) UniProt: 165-230                   --Exon 1.7  PDB: B:160D-196 [INCOMPLETE]   -----------------------------------------------Exon 1.9  PDB: B:245-277         Exon 1.10a  PDB: B:278-326 UniProt: 354-406           Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------Exon 1.4  PDB: B:51-90 UniProt: 125-164 -----------------------------------------------------------------1.6 ---------------------------------------Exon 1.8  PDB: B:196-244 (gaps) UniProt: 273-320-------------------------------------------------------------------------------------- Transcript 1 (2)
                1bil B   -2 GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDS----SLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR  326
                                     7        17        27        37       46A|       55        65        75        85        95 ||    106       116       126       136       146       156  |    162       172       182       192       202       212       222       232       243       253       263       273      279D       289       299       309       319       
                                                                           46A|                                                 97|                                                         159 160D                                                                             240|                                  279A|||                                               
                                                                            46B                                                  99                                                                                                                                               242                                   279B||                                               
                                                                                                                                                                                                                                                                                                                         279C|                                               
                                                                                                                                                                                                                                                                                                                          279D

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Acid proteases (1120)

Superfamily: Acid proteases (1120)

Family: Pepsin-like (505)

Protein domain: Chymosin (synonym: renin) (67)

Human (Homo sapiens) [TaxId: 9606] (60)

1a	d1bila_	A:
1b	d1bilb_	B:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Beta Barrel (4804)

Topology: Cathepsin D, subunit A; domain 1 (745)

Homologous Superfamily: Acid Proteases (745)

Human (Homo sapiens) (161)

1a	1bilA02	A:171-325
1b	1bilB02	B:171-325
1c	1bilB01	B:1-170
1d	1bilA01	A:1-170

(no "Pfam Domain" information available for 1BIL)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (RENI_HUMAN | P00797)

molecular function
	GO:0004190	aspartic-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which a water molecule bound by the side chains of aspartic residues at the active center acts as a nucleophile.
	GO:0004175	endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0005159	insulin-like growth factor receptor binding	Interacting selectively and non-covalently with the insulin-like growth factor receptor.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
biological process
	GO:0050435	amyloid-beta metabolic process	The chemical reactions and pathways involving amyloid-beta, a glycoprotein associated with Alzheimer's disease, and its precursor, amyloid precursor protein (APP).
	GO:0002003	angiotensin maturation	The process leading to the attainment of the full functional capacity of angiotensin by conversion of renin substrate into mature angiotensin in the blood.
	GO:0048469	cell maturation	A developmental process, independent of morphogenetic (shape) change, that is required for a cell to attain its fully functional state.
	GO:0035690	cellular response to drug	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0042756	drinking behavior	The specific behavior of an organism relating to the intake of liquids, especially water.
	GO:0009755	hormone-mediated signaling pathway	A series of molecular signals mediated by the detection of a hormone.
	GO:0001822	kidney development	The process whose specific outcome is the progression of the kidney over time, from its formation to the mature structure. The kidney is an organ that filters the blood and/or excretes the end products of body metabolism in the form of urine.
	GO:0008584	male gonad development	The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
	GO:0001823	mesonephros development	The process whose specific outcome is the progression of the mesonephros over time, from its formation to the mature structure. In mammals, the mesonephros is the second of the three embryonic kidneys to be established and exists only transiently. In lower vertebrates such as fish and amphibia, the mesonephros will form the mature kidney.
	GO:0030163	protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0043408	regulation of MAPK cascade	Any process that modulates the frequency, rate or extent of signal transduction mediated by the MAP kinase (MAPK) cascade.
	GO:0008217	regulation of blood pressure	Any process that modulates the force with which blood travels through the circulatory system. The process is controlled by a balance of processes that increase pressure and decrease pressure.
	GO:0002016	regulation of blood volume by renin-angiotensin	The process in which the renin-angiotensin system controls the rate of fluid intake and output into the blood.
	GO:0002018	renin-angiotensin regulation of aldosterone production	The process in which an increase in active angiotensin stimulates the adrenal cortices to secrete aldosterone.
	GO:0051591	response to cAMP	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
	GO:0070305	response to cGMP	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cGMP (cyclic GMP, guanosine 3',5'-cyclophosphate) stimulus.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0035902	response to immobilization stress	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of being rendered immobile.
	GO:0032496	response to lipopolysaccharide	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0010033	response to organic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0005764	lysosome	A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		0IU	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:296 - Pro A:297	[ RasMol ]
		Gly B:296 - Pro B:297	[ RasMol ]
		Leu A:110 - Pro A:111	[ RasMol ]
		Leu B:110 - Pro B:111	[ RasMol ]
		Pro A:293 - Pro A:294	[ RasMol ]
		Pro B:293 - Pro B:294	[ RasMol ]
		Thr A:22 - Pro A:23	[ RasMol ]
		Thr B:22 - Pro B:23	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)
Prepi
	ribbon, secondary structure, SS bonds, chain specific coloring; ligands: spacefill [ mono GIF format \| stereo GIF format ]
	ribbon, secondary structure, SS bonds, chain specific coloring; ligands: spacefill; white background [ mono GIF format \| stereo GIF format ]
	protein: Calpha trace, chain-specific coloring, sequence; ligands: spacefill [ mono GIF format \| stereo GIF format ]
	spacefill, chain-specific coloring [ mono GIF format \| stereo GIF format ]

Access by PDB/NDB ID
	1bil
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RENI_HUMAN \| P00797
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.23.15
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	267430
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	RENI_HUMAN \| P00797
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1BIL)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (6, 6)

Cis Peptide Bonds (8, 8)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 8)

PROSITE Motifs (2, 6)

Exons (9, 18)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (34, 34)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File