3OWN - JenaLib

Asymmetric Unit (4, 7)

No.	Name	Count	Type	Full Name
1	3OW	1	Ligand/Ion	(2S,4S)-4-HYDROXY-2-(1-METHYLETHYL)-4-[(4S,13S)-18-[METHYL(METHYLSULFONYL)AMINO]-2,15-DIOXO-4-PHENYL-11-OXA-3,14-DIAZATRICYCLO[14.3.1.1~5,9~]HENICOSA-1(20),5(21),6,8,16,18-HEXAEN-13-YL]-N-(2-METHYLPROPYL)BUTANAMIDE
2	3OX	1	Ligand/Ion	(2S,4S)-4-HYDROXY-2-(1-METHYLETHYL)-4-[(4R,13S)-18-[METHYL(METHYLSULFONYL)AMINO]-2,15-DIOXO-4-PHENYL-11-OXA-3,14-DIAZATRICYCLO[14.3.1.1~5,9~]HENICOSA-1(20),5(21),6,8,16,18-HEXAEN-13-YL]-N-(2-METHYLPROPYL)BUTANAMIDE
3	ACT	3	Ligand/Ion	ACETATE ION
4	NA	2	Ligand/Ion	SODIUM ION

Biological Unit 1 (2, 4)

No.	Name	Count	Type	Full Name
1	3OW	-1	Ligand/Ion	(2S,4S)-4-HYDROXY-2-(1-METHYLETHYL)-4-[(4S,13S)-18-[METHYL(METHYLSULFONYL)AMINO]-2,15-DIOXO-4-PHENYL-11-OXA-3,14-DIAZATRICYCLO[14.3.1.1~5,9~]HENICOSA-1(20),5(21),6,8,16,18-HEXAEN-13-YL]-N-(2-METHYLPROPYL)BUTANAMIDE
2	3OX	1	Ligand/Ion	(2S,4S)-4-HYDROXY-2-(1-METHYLETHYL)-4-[(4R,13S)-18-[METHYL(METHYLSULFONYL)AMINO]-2,15-DIOXO-4-PHENYL-11-OXA-3,14-DIAZATRICYCLO[14.3.1.1~5,9~]HENICOSA-1(20),5(21),6,8,16,18-HEXAEN-13-YL]-N-(2-METHYLPROPYL)BUTANAMIDE
3	ACT	3	Ligand/Ion	ACETATE ION
4	NA	-1	Ligand/Ion	SODIUM ION

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	3OW	1	Ligand/Ion	(2S,4S)-4-HYDROXY-2-(1-METHYLETHYL)-4-[(4S,13S)-18-[METHYL(METHYLSULFONYL)AMINO]-2,15-DIOXO-4-PHENYL-11-OXA-3,14-DIAZATRICYCLO[14.3.1.1~5,9~]HENICOSA-1(20),5(21),6,8,16,18-HEXAEN-13-YL]-N-(2-METHYLPROPYL)BUTANAMIDE
2	3OX	-1	Ligand/Ion	(2S,4S)-4-HYDROXY-2-(1-METHYLETHYL)-4-[(4R,13S)-18-[METHYL(METHYLSULFONYL)AMINO]-2,15-DIOXO-4-PHENYL-11-OXA-3,14-DIAZATRICYCLO[14.3.1.1~5,9~]HENICOSA-1(20),5(21),6,8,16,18-HEXAEN-13-YL]-N-(2-METHYLPROPYL)BUTANAMIDE
3	ACT	-1	Ligand/Ion	ACETATE ION
4	NA	-1	Ligand/Ion	SODIUM ION

Biological Unit 3 (2, 12)

No.	Name	Count	Type	Full Name
1	3OW	-1	Ligand/Ion	(2S,4S)-4-HYDROXY-2-(1-METHYLETHYL)-4-[(4S,13S)-18-[METHYL(METHYLSULFONYL)AMINO]-2,15-DIOXO-4-PHENYL-11-OXA-3,14-DIAZATRICYCLO[14.3.1.1~5,9~]HENICOSA-1(20),5(21),6,8,16,18-HEXAEN-13-YL]-N-(2-METHYLPROPYL)BUTANAMIDE
2	3OX	3	Ligand/Ion	(2S,4S)-4-HYDROXY-2-(1-METHYLETHYL)-4-[(4R,13S)-18-[METHYL(METHYLSULFONYL)AMINO]-2,15-DIOXO-4-PHENYL-11-OXA-3,14-DIAZATRICYCLO[14.3.1.1~5,9~]HENICOSA-1(20),5(21),6,8,16,18-HEXAEN-13-YL]-N-(2-METHYLPROPYL)BUTANAMIDE
3	ACT	9	Ligand/Ion	ACETATE ION
4	NA	-1	Ligand/Ion	SODIUM ION

Biological Unit 4 (1, 3)

No.	Name	Count	Type	Full Name
1	3OW	3	Ligand/Ion	(2S,4S)-4-HYDROXY-2-(1-METHYLETHYL)-4-[(4S,13S)-18-[METHYL(METHYLSULFONYL)AMINO]-2,15-DIOXO-4-PHENYL-11-OXA-3,14-DIAZATRICYCLO[14.3.1.1~5,9~]HENICOSA-1(20),5(21),6,8,16,18-HEXAEN-13-YL]-N-(2-METHYLPROPYL)BUTANAMIDE
2	3OX	-1	Ligand/Ion	(2S,4S)-4-HYDROXY-2-(1-METHYLETHYL)-4-[(4R,13S)-18-[METHYL(METHYLSULFONYL)AMINO]-2,15-DIOXO-4-PHENYL-11-OXA-3,14-DIAZATRICYCLO[14.3.1.1~5,9~]HENICOSA-1(20),5(21),6,8,16,18-HEXAEN-13-YL]-N-(2-METHYLPROPYL)BUTANAMIDE
3	ACT	-1	Ligand/Ion	ACETATE ION
4	NA	-1	Ligand/Ion	SODIUM ION

Biological Unit 5 (3, 15)

No.	Name	Count	Type	Full Name
1	3OW	3	Ligand/Ion	(2S,4S)-4-HYDROXY-2-(1-METHYLETHYL)-4-[(4S,13S)-18-[METHYL(METHYLSULFONYL)AMINO]-2,15-DIOXO-4-PHENYL-11-OXA-3,14-DIAZATRICYCLO[14.3.1.1~5,9~]HENICOSA-1(20),5(21),6,8,16,18-HEXAEN-13-YL]-N-(2-METHYLPROPYL)BUTANAMIDE
2	3OX	3	Ligand/Ion	(2S,4S)-4-HYDROXY-2-(1-METHYLETHYL)-4-[(4R,13S)-18-[METHYL(METHYLSULFONYL)AMINO]-2,15-DIOXO-4-PHENYL-11-OXA-3,14-DIAZATRICYCLO[14.3.1.1~5,9~]HENICOSA-1(20),5(21),6,8,16,18-HEXAEN-13-YL]-N-(2-METHYLPROPYL)BUTANAMIDE
3	ACT	9	Ligand/Ion	ACETATE ION
4	NA	-1	Ligand/Ion	SODIUM ION

Sites (7, 7)

SS Bonds (6, 6)

Cis Peptide Bonds (8, 8)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 8)

Asymmetric Unit (4, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035088	D	104	N	RENI_HUMAN	Disease (RTD)	868694193	A/B	D	35	N
2	UniProt	VAR_029171	Q	160	K	RENI_HUMAN	Polymorphism	11571083	A/B	Q	91	K
3	UniProt	VAR_020376	G	217	R	RENI_HUMAN	Polymorphism	11571117	A/B	G	148	R
4	UniProt	VAR_035087	R	230	K	RENI_HUMAN	Disease (RTD)	121917742	A/B	R	161	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035088	D	104	N	RENI_HUMAN	Disease (RTD)	868694193	A	D	35	N
2	UniProt	VAR_029171	Q	160	K	RENI_HUMAN	Polymorphism	11571083	A	Q	91	K
3	UniProt	VAR_020376	G	217	R	RENI_HUMAN	Polymorphism	11571117	A	G	148	R
4	UniProt	VAR_035087	R	230	K	RENI_HUMAN	Disease (RTD)	121917742	A	R	161	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035088	D	104	N	RENI_HUMAN	Disease (RTD)	868694193	B	D	35	N
2	UniProt	VAR_029171	Q	160	K	RENI_HUMAN	Polymorphism	11571083	B	Q	91	K
3	UniProt	VAR_020376	G	217	R	RENI_HUMAN	Polymorphism	11571117	B	G	148	R
4	UniProt	VAR_035087	R	230	K	RENI_HUMAN	Disease (RTD)	121917742	B	R	161	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (4, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035088	D	104	N	RENI_HUMAN	Disease (RTD)	868694193	A	D	35	N
2	UniProt	VAR_029171	Q	160	K	RENI_HUMAN	Polymorphism	11571083	A	Q	91	K
3	UniProt	VAR_020376	G	217	R	RENI_HUMAN	Polymorphism	11571117	A	G	148	R
4	UniProt	VAR_035087	R	230	K	RENI_HUMAN	Disease (RTD)	121917742	A	R	161	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (4, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035088	D	104	N	RENI_HUMAN	Disease (RTD)	868694193	B	D	35	N
2	UniProt	VAR_029171	Q	160	K	RENI_HUMAN	Polymorphism	11571083	B	Q	91	K
3	UniProt	VAR_020376	G	217	R	RENI_HUMAN	Polymorphism	11571117	B	G	148	R
4	UniProt	VAR_035087	R	230	K	RENI_HUMAN	Disease (RTD)	121917742	B	R	161	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (4, 24)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035088	D	104	N	RENI_HUMAN	Disease (RTD)	868694193	A/B	D	35	N
2	UniProt	VAR_029171	Q	160	K	RENI_HUMAN	Polymorphism	11571083	A/B	Q	91	K
3	UniProt	VAR_020376	G	217	R	RENI_HUMAN	Polymorphism	11571117	A/B	G	148	R
4	UniProt	VAR_035087	R	230	K	RENI_HUMAN	Disease (RTD)	121917742	A/B	R	161	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (2, 6)

Asymmetric Unit (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PEPTIDASE_A1	PS51767	Peptidase family A1 domain profile.	RENI_HUMAN	86-403	2	A:17-334 B:17-334
2	ASP_PROTEASE	PS00141	Eukaryotic and viral aspartyl proteases active site.	RENI_HUMAN	101-112 289-300	4	A:32-43 B:32-43 A:220-231 B:220-231

Biological Unit 1 (2, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PEPTIDASE_A1	PS51767	Peptidase family A1 domain profile.	RENI_HUMAN	86-403	1	A:17-334 -
2	ASP_PROTEASE	PS00141	Eukaryotic and viral aspartyl proteases active site.	RENI_HUMAN	101-112 289-300	2	A:32-43 - A:220-231 -

Biological Unit 2 (2, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PEPTIDASE_A1	PS51767	Peptidase family A1 domain profile.	RENI_HUMAN	86-403	1	- B:17-334
2	ASP_PROTEASE	PS00141	Eukaryotic and viral aspartyl proteases active site.	RENI_HUMAN	101-112 289-300	2	- B:32-43 - B:220-231

Biological Unit 3 (2, 9)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PEPTIDASE_A1	PS51767	Peptidase family A1 domain profile.	RENI_HUMAN	86-403	3	A:17-334 -
2	ASP_PROTEASE	PS00141	Eukaryotic and viral aspartyl proteases active site.	RENI_HUMAN	101-112 289-300	6	A:32-43 - A:220-231 -

Biological Unit 4 (2, 9)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PEPTIDASE_A1	PS51767	Peptidase family A1 domain profile.	RENI_HUMAN	86-403	3	- B:17-334
2	ASP_PROTEASE	PS00141	Eukaryotic and viral aspartyl proteases active site.	RENI_HUMAN	101-112 289-300	6	- B:32-43 - B:220-231

Biological Unit 5 (2, 18)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PEPTIDASE_A1	PS51767	Peptidase family A1 domain profile.	RENI_HUMAN	86-403	6	A:17-334 B:17-334
2	ASP_PROTEASE	PS00141	Eukaryotic and viral aspartyl proteases active site.	RENI_HUMAN	101-112 289-300	12	A:32-43 B:32-43 A:220-231 B:220-231

Exons (9, 18)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:334
 aligned with RENI_HUMAN | P00797 from UniProtKB/Swiss-Prot  Length:406

    Alignment length:337
                                    79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       
           RENI_HUMAN    70 GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR 406
               SCOP domains d3owna_ A: Chymosin (synonym: renin)                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeee...eeeeeeee....eeeeeeee.....eeee.......hhhhhhh...hhhhh...eeeeeeeeeee..eeeeeeeeeeeeee..eeeeeeeeeeee.hhhhhh.....eeee..hhhhhhhhh.hhhhhhhh.......eeeeee....---....eeeee...hhh.eeeeeeeee.......eeeeeeeee..eeee....eeeee......eeehhhhhhhhhhhhh.ee....eeee.hhhhhh..eeeee..eeeeehhhhhh.........eee..eee..........eeehhhhhh.eeeeee....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------N-------------------------------------------------------K--------------------------------------------------------R------------K-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------PEPTIDASE_A1  PDB: A:17-334 UniProt: 86-403                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) -------------------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE---------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2      Exon 1.3  PDB: A:15-56 UniProt: 84-125    ---------------------------------------Exon 1.5  PDB: A:96-161 UniProt: 165-230                          --Exon 1.7  PDB: A:167-204 UniProt: 233-273-----------------------------------------------Exon 1.9  PDB: A:252-284         Exon 1.10a  PDB: A:285-337 UniProt: 354-406           Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------Exon 1.4  PDB: A:56-95 UniProt: 125-164 -----------------------------------------------------------------1.6 ---------------------------------------Exon 1.8  PDB: A:204-251 UniProt: 273-320       -------------------------------------------------------------------------------------- Transcript 1 (2)
                 3own A   1 GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDS---QSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR 337
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160  |   |170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       
                                                                                                                                                                                            163 167

Chain B from PDB  Type:PROTEIN  Length:334
 aligned with RENI_HUMAN | P00797 from UniProtKB/Swiss-Prot  Length:406

    Alignment length:337
                                    79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       
           RENI_HUMAN    70 GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR 406
               SCOP domains d3ownb_ B: Chymosin (synonym: renin)                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---------------Asp-3ownB01 B:16-336                                                                                                                                                                                                                                                                                                             - Pfam domains (1)
           Pfam domains (2) ---------------Asp-3ownB02 B:16-336                                                                                                                                                                                                                                                                                                             - Pfam domains (2)
         Sec.struct. author ....eeeeeeee...eeeeeeee....eeeeeeee.....eeee.......hhhhhhh...hhhhh...eeeeeeeeeee..eeeeeeeeeeeeee..eeeeeeeeeeee.hhhhhh.....eeee..hhhhhhhhh.hhhhhhhh.......eeeeee.....---...eeeee...hhh.eeeeeeeee.......eeee..eee..eeee....eeeee......eeehhhhhhhhhhhhh.ee....eeee.hhhhhh..eeeee..eeeeehhhhhh.........eee..eee..........eeehhhhhhheeeeee....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------N-------------------------------------------------------K--------------------------------------------------------R------------K-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------PEPTIDASE_A1  PDB: B:17-334 UniProt: 86-403                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) -------------------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE---------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2      Exon 1.3  PDB: B:15-56 UniProt: 84-125    ---------------------------------------Exon 1.5  PDB: B:96-161 UniProt: 165-230                          --Exon 1.7  PDB: B:164-204 (gaps)          -----------------------------------------------Exon 1.9  PDB: B:252-284         Exon 1.10a  PDB: B:285-337 UniProt: 354-406           Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------Exon 1.4  PDB: B:56-95 UniProt: 125-164 -----------------------------------------------------------------1.6 ---------------------------------------Exon 1.8  PDB: B:204-251 UniProt: 273-320       -------------------------------------------------------------------------------------- Transcript 1 (2)
                 3own B   1 GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSE---SLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR 337
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160   |   170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       
                                                                                                                                                                                             164 168

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (34, 34)

Asymmetric Unit(hide GO term definitions)

Chain A,B (RENI_HUMAN | P00797)

molecular function
	GO:0004190	aspartic-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which a water molecule bound by the side chains of aspartic residues at the active center acts as a nucleophile.
	GO:0004175	endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0005159	insulin-like growth factor receptor binding	Interacting selectively and non-covalently with the insulin-like growth factor receptor.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
biological process
	GO:0050435	amyloid-beta metabolic process	The chemical reactions and pathways involving amyloid-beta, a glycoprotein associated with Alzheimer's disease, and its precursor, amyloid precursor protein (APP).
	GO:0002003	angiotensin maturation	The process leading to the attainment of the full functional capacity of angiotensin by conversion of renin substrate into mature angiotensin in the blood.
	GO:0048469	cell maturation	A developmental process, independent of morphogenetic (shape) change, that is required for a cell to attain its fully functional state.
	GO:0035690	cellular response to drug	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0042756	drinking behavior	The specific behavior of an organism relating to the intake of liquids, especially water.
	GO:0009755	hormone-mediated signaling pathway	A series of molecular signals mediated by the detection of a hormone.
	GO:0001822	kidney development	The process whose specific outcome is the progression of the kidney over time, from its formation to the mature structure. The kidney is an organ that filters the blood and/or excretes the end products of body metabolism in the form of urine.
	GO:0008584	male gonad development	The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
	GO:0001823	mesonephros development	The process whose specific outcome is the progression of the mesonephros over time, from its formation to the mature structure. In mammals, the mesonephros is the second of the three embryonic kidneys to be established and exists only transiently. In lower vertebrates such as fish and amphibia, the mesonephros will form the mature kidney.
	GO:0030163	protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0043408	regulation of MAPK cascade	Any process that modulates the frequency, rate or extent of signal transduction mediated by the MAP kinase (MAPK) cascade.
	GO:0008217	regulation of blood pressure	Any process that modulates the force with which blood travels through the circulatory system. The process is controlled by a balance of processes that increase pressure and decrease pressure.
	GO:0002016	regulation of blood volume by renin-angiotensin	The process in which the renin-angiotensin system controls the rate of fluid intake and output into the blood.
	GO:0002018	renin-angiotensin regulation of aldosterone production	The process in which an increase in active angiotensin stimulates the adrenal cortices to secrete aldosterone.
	GO:0051591	response to cAMP	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
	GO:0070305	response to cGMP	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cGMP (cyclic GMP, guanosine 3',5'-cyclophosphate) stimulus.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0035902	response to immobilization stress	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of being rendered immobile.
	GO:0032496	response to lipopolysaccharide	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0010033	response to organic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0005764	lysosome	A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		3OW	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		3OX	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ACT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:307 - Pro A:308	[ RasMol ]
		Gly B:307 - Pro B:308	[ RasMol ]
		Leu A:114 - Pro A:115	[ RasMol ]
		Leu B:114 - Pro B:115	[ RasMol ]
		Pro A:304 - Pro A:305	[ RasMol ]
		Pro B:304 - Pro B:305	[ RasMol ]
		Thr A:25 - Pro A:26	[ RasMol ]
		Thr B:25 - Pro B:26	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 7)

Sites (7, 7)

SS Bonds (6, 6)

Cis Peptide Bonds (8, 8)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 8)

PROSITE Motifs (2, 6)

Exons (9, 18)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (34, 34)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File