Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE ANALYSIS OF RENIN-INDOLE-PIPERAZINE INHIBITOR COMPLEXES
 
Authors :  Z. Bocskei
Date :  03 Sep 10  (Deposition) - 13 Oct 10  (Release) - 09 Mar 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.78
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Renin Human, Aspartyl Protease, Renin Inhibition, Hypertension, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. Scheiper, H. Matter, H. Steinhagen, U. Stilz, Z. Bocskei, V. Fleury G. Mccort
Discovery And Optimization Of A New Class Of Potent And Non-Chiral Indole-3-Carboxamide-Based Renin Inhibitors.
Bioorg. Med. Chem. Lett. V. 20 6268 2010
PubMed-ID: 20850300  |  Reference-DOI: 10.1016/J.BMCL.2010.08.092

(-) Compounds

Molecule 1 - RENIN
    ChainsA, B
    EC Number3.4.23.15
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHUMAN EMBRYONIC KIDNEY CELL (CRL-1573)
    Expression System CommonHUMAN
    Expression System Taxid9606
    FragmentUNP RESIDUES 67-406
    GeneREN
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymANGIOTENSINOGENASE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric Unit (2, 4)
No.NameCountTypeFull Name
1NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
2S512Ligand/Ion2-BENZYL-1-PHENYL-3-(PIPERAZIN-1-YLCARBONYL)-1H-INDOLE
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
1NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE
2S511Ligand/Ion2-BENZYL-1-PHENYL-3-(PIPERAZIN-1-YLCARBONYL)-1H-INDOLE
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
1NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE
2S511Ligand/Ion2-BENZYL-1-PHENYL-3-(PIPERAZIN-1-YLCARBONYL)-1H-INDOLE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:67 , MET A:100BINDING SITE FOR RESIDUE NAG A 367
2AC2SOFTWAREGLN A:13 , ASP A:32 , TYR A:75 , THR A:77 , PRO A:111 , VAL A:120 , ASP A:215 , GLY A:217 , SER A:219 , MET A:289BINDING SITE FOR RESIDUE S51 A 328
3AC3SOFTWAREASN B:67 , MET B:100BINDING SITE FOR RESIDUE NAG B 367
4AC4SOFTWAREGLN B:13 , ASP B:32 , TYR B:75 , THR B:77 , VAL B:120 , ASP B:215 , GLY B:217BINDING SITE FOR RESIDUE S51 B 328

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:45 -A:50
2A:206 -A:210
3A:249 -A:282
4B:45 -B:50
5B:206 -B:210
6B:249 -B:282

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Thr A:22 -Pro A:23
2Leu A:110 -Pro A:111
3Pro A:293 -Pro A:294
4Gly A:296 -Pro A:297
5Thr B:22 -Pro B:23
6Leu B:110 -Pro B:111
7Pro B:293 -Pro B:294
8Gly B:296 -Pro B:297

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (4, 8)

Asymmetric Unit (4, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_035088D104NRENI_HUMANDisease (RTD)868694193A/BD32N
2UniProtVAR_029171Q160KRENI_HUMANPolymorphism11571083A/BQ86K
3UniProtVAR_020376G217RRENI_HUMANPolymorphism11571117A/BG144R
4UniProtVAR_035087R230KRENI_HUMANDisease (RTD)121917742A/BR157K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_035088D104NRENI_HUMANDisease (RTD)868694193AD32N
2UniProtVAR_029171Q160KRENI_HUMANPolymorphism11571083AQ86K
3UniProtVAR_020376G217RRENI_HUMANPolymorphism11571117AG144R
4UniProtVAR_035087R230KRENI_HUMANDisease (RTD)121917742AR157K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_035088D104NRENI_HUMANDisease (RTD)868694193BD32N
2UniProtVAR_029171Q160KRENI_HUMANPolymorphism11571083BQ86K
3UniProtVAR_020376G217RRENI_HUMANPolymorphism11571117BG144R
4UniProtVAR_035087R230KRENI_HUMANDisease (RTD)121917742BR157K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 6)

Asymmetric Unit (2, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PEPTIDASE_A1PS51767 Peptidase family A1 domain profile.RENI_HUMAN86-403
 
  2A:14-323
B:14-323
2ASP_PROTEASEPS00141 Eukaryotic and viral aspartyl proteases active site.RENI_HUMAN101-112
 
289-300
 
  4A:29-40
B:29-40
A:212-223
B:212-223
Biological Unit 1 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PEPTIDASE_A1PS51767 Peptidase family A1 domain profile.RENI_HUMAN86-403
 
  1A:14-323
-
2ASP_PROTEASEPS00141 Eukaryotic and viral aspartyl proteases active site.RENI_HUMAN101-112
 
289-300
 
  2A:29-40
-
A:212-223
-
Biological Unit 2 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PEPTIDASE_A1PS51767 Peptidase family A1 domain profile.RENI_HUMAN86-403
 
  1-
B:14-323
2ASP_PROTEASEPS00141 Eukaryotic and viral aspartyl proteases active site.RENI_HUMAN101-112
 
289-300
 
  2-
B:29-40
-
B:212-223

(-) Exons   (9, 18)

Asymmetric Unit (9, 18)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000002721901bENSE00001952423chr1:204135450-204135324127RENI_HUMAN1-33330--
1.2ENST000002721902ENSE00000962217chr1:204131291-204131141151RENI_HUMAN33-83512A:-2-11
B:-2-11
14
14
1.3ENST000002721903ENSE00000962218chr1:204130543-204130420124RENI_HUMAN84-125422A:12-51
B:12-51
42
42
1.4ENST000002721904ENSE00001075102chr1:204129806-204129688119RENI_HUMAN125-164402A:51-90
B:51-90
40
40
1.5ENST000002721905ENSE00001075100chr1:204128723-204128527197RENI_HUMAN165-230662A:91-157 (gaps)
B:91-157 (gaps)
67
67
1.6ENST000002721906ENSE00001652153chr1:204126497-2041264899RENI_HUMAN230-23342A:157-160
B:157-160
4
4
1.7ENST000002721907ENSE00000962221chr1:204125924-204125805120RENI_HUMAN233-273412A:160-196
B:160-196
41
41
1.8ENST000002721908ENSE00001306111chr1:204125447-204125306142RENI_HUMAN273-320482A:196-244 (gaps)
B:196-244 (gaps)
49
49
1.9ENST000002721909ENSE00000962223chr1:204125046-20412494899RENI_HUMAN321-353332A:245-277
B:245-277
33
33
1.10aENST0000027219010aENSE00001947658chr1:204124305-204123947359RENI_HUMAN354-406532A:278-326
B:278-326
53
53

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:337
 aligned with RENI_HUMAN | P00797 from UniProtKB/Swiss-Prot  Length:406

    Alignment length:337
                                    79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       
          RENI_HUMAN     70 GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR  406
               SCOP domains d3oqfa_ A: Chymosin (synonym: renin)                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeee...eeeeeeee....eeeeeeee.....eeee.......hhhhhh....hhhhh...eeeeeeeeee....eeeeeeeeeeeee..eeeeeeeeeeee.hhhhhh.....eeee..hhhhhhhhh.hhhhhhhhh......eeeeee...........eeeee...hhh.eeeeeeeee.......eeee.eeee...eee....eeeee......eeehhhhhhhhhhhhh.ee....eeee.hhhhhh..eeeee..eeeeehhhhhh.........eee..eee..........eeehhhhhhheeeeee....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------N-------------------------------------------------------K--------------------------------------------------------R------------K-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------PEPTIDASE_A1  PDB: A:14-323 UniProt: 86-403                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) -------------------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE---------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2      Exon 1.3  PDB: A:12-51 UniProt: 84-125    ---------------------------------------Exon 1.5  PDB: A:91-157 (gaps) UniProt: 165-230                   --Exon 1.7  PDB: A:160-196 UniProt: 233-273-----------------------------------------------Exon 1.9  PDB: A:245-277         Exon 1.10a  PDB: A:278-326 UniProt: 354-406           Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------Exon 1.4  PDB: A:51-90 UniProt: 125-164 -----------------------------------------------------------------1.6 ---------------------------------------Exon 1.8  PDB: A:196-244 (gaps) UniProt: 273-320-------------------------------------------------------------------------------------- Transcript 1 (2)
                3oqf A   -2 GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR  326
                                     7        17        27        37       46A|       55        65        75        85        95 ||    106       116       126       136       146       156    |||162       172       182       192       202       212       222       232       243       253       263       273      279D       289       299       309       319       
                                                                           46A|                                                 97|                                                          160A|||                                                                             240|                                  279A|||                                               
                                                                            46B                                                  99                                                           160B||                                                                              242                                   279B||                                               
                                                                                                                                                                                               160C|                                                                                                                     279C|                                               
                                                                                                                                                                                                160D                                                                                                                      279D                                               

Chain B from PDB  Type:PROTEIN  Length:337
 aligned with RENI_HUMAN | P00797 from UniProtKB/Swiss-Prot  Length:406

    Alignment length:337
                                    79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       
          RENI_HUMAN     70 GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR  406
               SCOP domains d3oqfb_ B: Chymosin (synonym: renin)                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---------------Asp-3oqfB01 B:13-325                                                                                                                                                                                                                                                                                                             - Pfam domains (1)
           Pfam domains (2) ---------------Asp-3oqfB02 B:13-325                                                                                                                                                                                                                                                                                                             - Pfam domains (2)
         Sec.struct. author ....eeeeeeee...eeeeeeee....eeeeeeee.....eeee.......hhhhhh....hhhhh...eeeeeeeeee....eeeeeeeeeeeee..eeeeeeeeeeee.hhhhhh.....eeee..hhhhhhhhh.hhhhhhhhh......eeeeee...........eeeee...hhh.eeeeeeeee.......eeee.eeee..eeee....eeeee......eeehhhhhhhhhhhhh.ee....eeee.hhhhhh..eeeee..eeeeehhhhhh.........eee..eee..........eeehhhhhhheeeeee....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------N-------------------------------------------------------K--------------------------------------------------------R------------K-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------PEPTIDASE_A1  PDB: B:14-323 UniProt: 86-403                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) -------------------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE---------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2      Exon 1.3  PDB: B:12-51 UniProt: 84-125    ---------------------------------------Exon 1.5  PDB: B:91-157 (gaps) UniProt: 165-230                   --Exon 1.7  PDB: B:160-196 UniProt: 233-273-----------------------------------------------Exon 1.9  PDB: B:245-277         Exon 1.10a  PDB: B:278-326 UniProt: 354-406           Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------Exon 1.4  PDB: B:51-90 UniProt: 125-164 -----------------------------------------------------------------1.6 ---------------------------------------Exon 1.8  PDB: B:196-244 (gaps) UniProt: 273-320-------------------------------------------------------------------------------------- Transcript 1 (2)
                3oqf B   -2 GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR  326
                                     7        17        27        37       46A|       55        65        75        85        95 ||    106       116       126       136       146       156    |||162       172       182       192       202       212       222       232       243       253       263       273      279D       289       299       309       319       
                                                                           46A|                                                 97|                                                          160A|||                                                                             240|                                  279A|||                                               
                                                                            46B                                                  99                                                           160B||                                                                              242                                   279B||                                               
                                                                                                                                                                                               160C|                                                                                                                     279C|                                               
                                                                                                                                                                                                160D                                                                                                                      279D                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3OQF)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Family: Asp (155)
1aAsp-3oqfB01B:13-325
1bAsp-3oqfB02B:13-325

(-) Gene Ontology  (34, 34)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (RENI_HUMAN | P00797)
molecular function
    GO:0004190    aspartic-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which a water molecule bound by the side chains of aspartic residues at the active center acts as a nucleophile.
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0005159    insulin-like growth factor receptor binding    Interacting selectively and non-covalently with the insulin-like growth factor receptor.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
biological process
    GO:0050435    amyloid-beta metabolic process    The chemical reactions and pathways involving amyloid-beta, a glycoprotein associated with Alzheimer's disease, and its precursor, amyloid precursor protein (APP).
    GO:0002003    angiotensin maturation    The process leading to the attainment of the full functional capacity of angiotensin by conversion of renin substrate into mature angiotensin in the blood.
    GO:0048469    cell maturation    A developmental process, independent of morphogenetic (shape) change, that is required for a cell to attain its fully functional state.
    GO:0035690    cellular response to drug    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0042756    drinking behavior    The specific behavior of an organism relating to the intake of liquids, especially water.
    GO:0009755    hormone-mediated signaling pathway    A series of molecular signals mediated by the detection of a hormone.
    GO:0001822    kidney development    The process whose specific outcome is the progression of the kidney over time, from its formation to the mature structure. The kidney is an organ that filters the blood and/or excretes the end products of body metabolism in the form of urine.
    GO:0008584    male gonad development    The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
    GO:0001823    mesonephros development    The process whose specific outcome is the progression of the mesonephros over time, from its formation to the mature structure. In mammals, the mesonephros is the second of the three embryonic kidneys to be established and exists only transiently. In lower vertebrates such as fish and amphibia, the mesonephros will form the mature kidney.
    GO:0030163    protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0043408    regulation of MAPK cascade    Any process that modulates the frequency, rate or extent of signal transduction mediated by the MAP kinase (MAPK) cascade.
    GO:0008217    regulation of blood pressure    Any process that modulates the force with which blood travels through the circulatory system. The process is controlled by a balance of processes that increase pressure and decrease pressure.
    GO:0002016    regulation of blood volume by renin-angiotensin    The process in which the renin-angiotensin system controls the rate of fluid intake and output into the blood.
    GO:0002018    renin-angiotensin regulation of aldosterone production    The process in which an increase in active angiotensin stimulates the adrenal cortices to secrete aldosterone.
    GO:0051591    response to cAMP    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
    GO:0070305    response to cGMP    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cGMP (cyclic GMP, guanosine 3',5'-cyclophosphate) stimulus.
    GO:0042493    response to drug    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0035902    response to immobilization stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of being rendered immobile.
    GO:0032496    response to lipopolysaccharide    Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
    GO:0010033    response to organic substance    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0005764    lysosome    A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    S51  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:296 - Pro A:297   [ RasMol ]  
    Gly B:296 - Pro B:297   [ RasMol ]  
    Leu A:110 - Pro A:111   [ RasMol ]  
    Leu B:110 - Pro B:111   [ RasMol ]  
    Pro A:293 - Pro A:294   [ RasMol ]  
    Pro B:293 - Pro B:294   [ RasMol ]  
    Thr A:22 - Pro A:23   [ RasMol ]  
    Thr B:22 - Pro B:23   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3oqf
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RENI_HUMAN | P00797
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.23.15
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  267430
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RENI_HUMAN | P00797
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RENI_HUMAN | P007971bbs 1bil 1bim 1hrn 1rne 2bks 2bkt 2fs4 2g1n 2g1o 2g1r 2g1s 2g1y 2g20 2g21 2g22 2g24 2g26 2g27 2i4q 2iko 2iku 2il2 2ren 2v0z 2v10 2v11 2v12 2v13 2v16 2x0b 3d91 3g6z 3g70 3g72 3gw5 3k1w 3km4 3o9l 3oad 3oag 3oot 3oqk 3own 3q3t 3q4b 3q5h 3sfc 3vcm 3vsw 3vsx 3vuc 3vyd 3vye 3vyf 4amt 4gj5 4gj6 4gj7 4gj8 4gj9 4gja 4gjb 4gjc 4gjd 4pyv 4q1n 4ryc 4ryg 4rz1 4s1g 4xx3 4xx4 5koq 5kos 5kot 5sxn 5sy2 5sy3 5sz9 5t4s

(-) Related Entries Specified in the PDB File

3oot 3oqk