5B3S - JenaLib

Asymmetric Unit (102, 102)

No.	Name	Evidence	Residues	Description
001	AC1	SOFTWARE	ALA A:24 , GLY A:27 , MET A:28 , THR A:31 , SER A:34 , ILE A:37 , ARG A:38 , TYR A:54 , VAL A:58 , HIS A:61 , ALA A:62 , MET A:65 , ILE A:66 , VAL A:70 , ILE A:73 , GLY A:125 , TRP A:126 , TYR A:371 , PHE A:377 , HIS A:378 , SER A:382 , VAL A:386 , PHE A:393 , MET A:417 , PHE A:425 , GLN A:428 , ARG A:438 , ARG A:439 , TYR A:440 , VAL A:465 , MET A:468 , HOH A:706 , HOH A:732 , HOH A:738 , HOH A:745	binding site for residue HEA A 601
002	AC2	SOFTWARE	TRP A:126 , TRP A:236 , VAL A:243 , TYR A:244 , HIS A:290 , HIS A:291 , THR A:309 , ILE A:312 , THR A:316 , GLY A:317 , GLY A:352 , LEU A:353 , GLY A:355 , ILE A:356 , LEU A:358 , ALA A:359 , ASP A:364 , HIS A:368 , VAL A:373 , HIS A:376 , PHE A:377 , VAL A:380 , LEU A:381 , ARG A:438 , CMO A:606 , HOH A:740 , HOH A:753 , HOH A:804 , HOH A:817 , ILE B:34	binding site for residue HEA A 602
003	AC3	SOFTWARE	HIS A:240 , HIS A:290 , HIS A:291 , CMO A:606	binding site for residue CU A 603
004	AC4	SOFTWARE	HIS A:368 , ASP A:369 , GLU B:198 , HOH B:410 , HOH B:459 , HOH B:563	binding site for residue MG A 604
005	AC5	SOFTWARE	GLU A:40 , GLY A:45 , SER A:441 , HOH A:836	binding site for residue NA A 605
006	AC6	SOFTWARE	HIS A:240 , VAL A:243 , HIS A:291 , HEA A:602 , CU A:603	binding site for residue CMO A 606
007	AC7	SOFTWARE	ASN A:406 , THR A:408 , HOH A:705 , HOH A:727 , HOH A:905 , PHE K:9 , HIS K:10 , HOH K:225 , ALA M:16 , LEU M:19 , SER M:20 , HOH M:226	binding site for residue PGV A 607
008	AC8	SOFTWARE	PHE A:94 , PRO A:95 , ARG A:96 , MET A:97 , HOH A:802 , HIS C:9 , GLY C:20 , ALA C:24 , ASN C:50 , TRP C:57 , TRP C:58 , GLU C:64 , HIS C:71 , LEU C:79 , GLY C:82 , PEK C:302 , HOH C:455	binding site for residue PGV A 608
009	AC9	SOFTWARE	TYR A:260 , TYR A:261 , HIS A:395 , TRP A:494 , HOH A:731 , HOH A:757 , ILE M:1	binding site for residue EDO A 609
010	AD1	SOFTWARE	LEU A:483 , VAL A:485 , THR A:488 , TRP A:494 , CYS A:498 , HOH A:707 , HOH A:854	binding site for residue EDO A 610
011	AD2	SOFTWARE	TYR A:510 , HOH A:713 , HOH A:847 , PRO F:36 , LYS F:37 , THR F:39 , LEU F:48	binding site for residue EDO A 611
012	AD3	SOFTWARE	ARG A:5 , ASN A:11 , LYS A:13 , ASP A:14 , TRP A:81 , PRO A:500 , TYR A:502 , ASN L:10	binding site for residue EDO A 612
013	AD4	SOFTWARE	GLY A:269 , MET A:271 , GLY A:272 , HOH A:871 , GLN B:59 , HOH B:423	binding site for residue EDO A 613
014	AD5	SOFTWARE	HOH L:233	binding site for residue EDO A 614
015	AD6	SOFTWARE	TYR A:304 , CDL T:102	binding site for residue EDO A 615
016	AD7	SOFTWARE	PHE A:346 , TYR A:379 , ASN A:422 , PHE A:430 , LEU A:433 , LEU B:7 , LEU B:28 , VAL B:31 , PHE B:32 , SER B:35 , SER B:36 , LEU B:39 , HOH B:612	binding site for residue TGL B 301
017	AD8	SOFTWARE	HIS B:161 , CYS B:196 , GLU B:198 , CYS B:200 , HIS B:204 , MET B:207	binding site for residue CUA B 302
018	AD9	SOFTWARE	PHE A:321 , HIS A:328 , HOH A:846 , ILE B:41 , HIS B:52 , MET B:56 , ASP B:57 , VAL B:61 , TRP B:65 , HOH B:458 , HOH B:475 , ASP E:8 , LEU E:41 , HOH E:344 , HOH E:354 , ARG I:10 , HOH I:126	binding site for residue PSC B 303
019	AE1	SOFTWARE	MET A:271 , TRP A:275 , HOH A:871 , GLN B:59 , GLU B:62 , THR B:63 , HOH B:423 , HOH B:454 , PEK P:303 , EDO S:104 , ARG T:14 , ARG T:17 , PHE T:21 , GLY T:22	binding site for residue CHD B 304
020	AE2	SOFTWARE	TYR A:447 , HOH A:780 , ALA B:2 , GLN B:10 , LEU B:136 , PRO B:166 , TYR B:193 , HOH B:474	binding site for residue EDO B 305
021	AE3	SOFTWARE	HIS B:102 , GLU B:157 , ASP B:158 , HOH B:533	binding site for residue EDO B 306
022	AE4	SOFTWARE	GLU B:157 , HOH B:428 , HOH B:449 , HOH B:470 , EDO C:309	binding site for residue EDO B 307
023	AE5	SOFTWARE	TYR B:40 , ALA I:24	binding site for residue EDO B 308
024	AE6	SOFTWARE	HIS A:233 , ASP A:300 , THR A:301 , TYR A:304 , HOH A:720 , TRP C:99 , HIS C:103 , HOH C:469 , HOH C:488 , LEU P:127	binding site for residue CHD C 301
025	AE7	SOFTWARE	PGV A:608 , HOH A:959 , TRP C:34 , TYR C:181 , TYR C:182 , ALA C:184 , PHE C:186 , THR C:187 , ILE C:188 , PHE C:198 , GLY C:202 , DMU C:308 , TRP G:62 , THR G:68 , PHE G:69 , PHE G:70 , HIS G:71 , ASN G:76 , HOH G:239	binding site for residue PEK C 302
026	AE8	SOFTWARE	LYS C:157 , HIS C:158 , GLN C:161 , ALA F:1 , ARG G:17 , CDL G:101 , CHD G:102 , GLN O:59 , HOH O:470	binding site for residue PEK C 303
027	AE9	SOFTWARE	MET C:54 , TRP C:58 , VAL C:61 , SER C:65 , THR C:66 , HIS C:71 , LEU C:206 , HIS C:207 , ILE C:210 , PHE C:214 , ARG C:221 , HIS C:226 , PHE C:227 , THR C:228 , HIS C:231 , HIS C:232 , PHE C:233 , GLY C:234 , CDL C:306 , HOH C:415 , HOH C:427 , HOH C:490 , HOH C:554 , HOH F:240	binding site for residue PGV C 304
028	AF1	SOFTWARE	TRP C:99 , TYR C:102 , HIS C:103 , ALA C:107 , HOH C:406 , HOH C:407 , HOH C:479 , HOH C:507 , HOH C:557 , ASN H:24 , HOH H:134 , CDL T:102	binding site for residue PGV C 305
029	AF2	SOFTWARE	MET C:51 , TYR C:55 , TRP C:58 , ARG C:59 , ILE C:62 , ARG C:63 , PHE C:67 , THR C:213 , PHE C:220 , LYS C:224 , HIS C:226 , PGV C:304 , HOH C:474 , HOH C:511 , HOH C:513 , HOH C:559	binding site for residue CDL C 306
030	AF3	SOFTWARE	ARG C:156 , LEU C:160 , GLN C:161 , PHE C:219 , PHE J:1	binding site for residue CHD C 307
031	AF4	SOFTWARE	TRP C:34 , MET C:40 , PEK C:302 , HOH C:403 , HOH C:464 , SER G:61 , TRP G:62 , GLY G:63	binding site for residue DMU C 308
032	AF5	SOFTWARE	GLY B:177 , EDO B:307 , HOH B:449 , GLU C:111 , EDO C:312 , HOH C:401 , HOH H:138	binding site for residue EDO C 309
033	AF6	SOFTWARE	TRP C:146 , SER C:150 , HIS C:158 , HOH C:426 , ALA F:1 , ARG G:17	binding site for residue EDO C 310
034	AF7	SOFTWARE	GLY B:177 , GLU C:111 , EDO C:309 , HOH C:401 , TRP H:68 , TRP H:72 , HOH H:132	binding site for residue EDO C 312
035	AF8	SOFTWARE	TRP A:334 , LEU A:342 , GLY A:343 , VAL A:419 , HOH A:708 , LEU B:39 , THR B:47 , HOH B:556 , HOH B:572 , HOH B:601 , ARG D:73 , TRP D:78 , EDO D:203 , HOH D:301 , HOH D:385 , ARG I:16 , HOH K:243	binding site for residue TGL D 201
036	AF9	SOFTWARE	LYS D:63 , ARG E:30	binding site for residue EDO D 202
037	AG1	SOFTWARE	TRP A:334 , TGL D:201 , HOH D:411 , HOH D:444	binding site for residue EDO D 203
038	AG2	SOFTWARE	TYR E:18 , LYS E:21 , GLU E:28 , HOH E:306	binding site for residue EDO E 201
039	AG3	SOFTWARE	HOH B:414 , PRO E:77 , HIS E:78 , HOH E:305 , HOH E:326 , HOH E:342	binding site for residue EDO E 202
040	AG4	SOFTWARE	ARG E:53 , ARG E:57 , HOH E:389	binding site for residue EDO E 203
041	AG5	SOFTWARE	CYS F:60 , CYS F:62 , CYS F:82 , CYS F:85	binding site for residue ZN F 101
042	AG6	SOFTWARE	THR A:490 , SER F:67 , THR F:68 , VAL F:69 , TRP F:71 , HOH F:227 , HOH F:244 , HOH F:273	binding site for residue EDO F 102
043	AG7	SOFTWARE	HIS C:231 , ASP F:9 , GLU F:17 , HOH F:213 , HOH F:234	binding site for residue EDO F 103
044	AG8	SOFTWARE	ASN C:125 , LEU C:127 , LEU C:131 , PEK C:303 , SER G:27 , LEU G:30 , CYS G:31 , ASN G:34 , LEU G:37 , HIS G:38 , PEK G:103 , HOH G:222 , PHE N:282 , ILE N:286 , ASP N:300 , SER N:307 , ILE N:311 , ALA O:77 , LEU O:78 , LEU O:81 , TYR O:85 , HOH O:530	binding site for residue CDL G 101
045	AG9	SOFTWARE	PEK C:303 , ARG G:14 , ARG G:17 , PHE G:21 , GLY G:22 , HOH G:203 , HOH G:204 , HOH G:211 , HOH G:229 , MET N:271 , TRP N:275 , GLU O:62 , THR O:63	binding site for residue CHD G 102
046	AH1	SOFTWARE	SER G:2 , ALA G:3 , HIS G:8 , CDL G:101 , PGV G:104 , HOH G:219 , TYR P:81 , ILE P:84 , THR P:95 , PHE P:98 , TRP P:240 , VAL P:247 , PHE P:251	binding site for residue PEK G 103
047	AH2	SOFTWARE	ALA G:1 , PEK G:103 , HOH G:201 , HOH G:206 , HOH G:212 , HOH G:218 , HOH G:286 , ASP N:298 , THR P:95 , TRP P:99 , HIS P:103 , ALA P:107 , CHD P:301 , HOH P:543 , ASN U:22	binding site for residue PGV G 104
048	AH3	SOFTWARE	GLY C:120 , ALA G:46 , PHE G:47 , ILE G:48 , LEU G:53 , ARG G:54 , HOH G:225	binding site for residue EDO G 105
049	AH4	SOFTWARE	LEU A:7 , TYR J:32 , ARG J:33 , THR J:37 , LEU J:40	binding site for residue CHD J 101
050	AH5	SOFTWARE	THR A:17 , LEU A:18 , TRP A:25 , PHE A:400 , ILE L:11 , PRO L:12 , PHE L:13 , SER L:14 , ARG L:20 , MET L:24 , PHE L:28 , PHE L:29 , SER L:31 , HOH L:238 , HOH L:241 , HOH L:245	binding site for residue TGL L 101
051	AH6	SOFTWARE	TRP D:98 , LEU M:27 , LEU M:28 , GLY M:31 , TRP M:32 , TYR M:35 , HIS M:36 , HOH M:201	binding site for residue DMU M 101
052	AH7	SOFTWARE	ARG L:41 , TRP M:32 , HIS M:36 , TYR M:40 , HOH M:228	binding site for residue EDO M 102
053	AH8	SOFTWARE	GLY N:27 , MET N:28 , THR N:31 , SER N:34 , ILE N:37 , ARG N:38 , TYR N:54 , VAL N:58 , HIS N:61 , ALA N:62 , MET N:65 , ILE N:66 , MET N:69 , VAL N:70 , ILE N:73 , GLY N:125 , TRP N:126 , TYR N:371 , PHE N:377 , HIS N:378 , SER N:382 , VAL N:386 , PHE N:393 , PHE N:425 , GLN N:428 , ARG N:438 , ARG N:439 , SER N:461 , VAL N:465 , MET N:468 , HOH N:713 , HOH N:731 , HOH N:736 , HOH N:820	binding site for residue HEA N 601
054	AH9	SOFTWARE	TRP N:126 , TRP N:236 , VAL N:243 , TYR N:244 , HIS N:290 , HIS N:291 , THR N:309 , ILE N:312 , ALA N:313 , THR N:316 , GLY N:317 , THR N:349 , GLY N:352 , LEU N:353 , GLY N:355 , ILE N:356 , LEU N:358 , ALA N:359 , ASP N:364 , HIS N:368 , VAL N:373 , HIS N:376 , PHE N:377 , VAL N:380 , LEU N:381 , ARG N:438 , CMO N:606 , HOH N:718 , HOH N:735 , HOH N:743 , HOH N:768 , ILE O:34	binding site for residue HEA N 602
055	AI1	SOFTWARE	HIS N:240 , HIS N:290 , HIS N:291 , CMO N:606	binding site for residue CU N 603
056	AI2	SOFTWARE	HIS N:368 , ASP N:369 , GLU O:198 , HOH O:406 , HOH O:466 , HOH O:550	binding site for residue MG N 604
057	AI3	SOFTWARE	GLU N:40 , GLY N:45 , SER N:441 , HOH N:870	binding site for residue NA N 605
058	AI4	SOFTWARE	HIS N:240 , VAL N:243 , HIS N:291 , HEA N:602 , CU N:603	binding site for residue CMO N 606
059	AI5	SOFTWARE	TYR N:379 , ASN N:422 , PHE N:426 , HIS N:429 , LEU N:433 , LEU O:7 , GLY O:8 , LEU O:28 , PHE O:32 , HOH O:592 , ARG V:43	binding site for residue TGL N 607
060	AI6	SOFTWARE	ASN N:406 , THR N:408 , TRP N:409 , ILE N:412 , HOH N:707 , HOH N:811 , HOH N:856 , PHE Q:87 , PHE X:9 , HIS X:10 , HOH X:216 , GLN Z:15 , LEU Z:19 , SER Z:20 , HOH Z:218	binding site for residue PGV N 608
061	AI7	SOFTWARE	PHE N:94 , PRO N:95 , ARG N:96 , MET N:97 , HOH N:766 , HIS P:9 , GLY P:20 , THR P:28 , ASN P:50 , TRP P:57 , TRP P:58 , VAL P:61 , GLU P:64 , HIS P:71 , LEU P:79 , GLY P:82 , PEK P:302 , HOH P:454	binding site for residue PGV N 609
062	AI8	SOFTWARE	TYR N:260 , TYR N:261 , HIS N:395 , TRP N:494 , HOH N:739 , HOH N:780	binding site for residue EDO N 610
063	AI9	SOFTWARE	HIS N:256 , LYS N:265 , THR N:490 , ASN N:491 , HOH N:764 , HOH N:846 , HOH N:871 , HOH N:873 , EDO S:102	binding site for residue EDO N 611
064	AJ1	SOFTWARE	THR N:484 , VAL N:485 , ASP N:486 , HOH N:705 , ILE Z:1 , THR Z:2	binding site for residue EDO N 612
065	AJ2	SOFTWARE	LEU N:483 , THR N:484 , VAL N:485 , TRP N:494 , GLY N:497 , CYS N:498 , HOH N:875 , TYR Q:11 , HOH Q:348	binding site for residue EDO N 613
066	AJ3	SOFTWARE	MET N:71 , ILE N:75 , GLY N:76 , SER N:157 , EDO N:616 , HOH N:709 , HOH N:722 , HOH N:775	binding site for residue EDO N 615
067	AJ4	SOFTWARE	TYR N:19 , ASN N:80 , ASN N:98 , GLY N:160 , PHE N:164 , EDO N:615 , HOH N:709 , HOH N:722	binding site for residue EDO N 616
068	AJ5	SOFTWARE	ASN N:496 , THR N:504 , PHE N:505 , GLU N:507 , HOH N:706 , HOH N:782 , HOH N:866 , HOH N:915 , TRP S:73	binding site for residue EDO N 617
069	AJ6	SOFTWARE	HIS O:161 , CYS O:196 , GLU O:198 , CYS O:200 , HIS O:204 , MET O:207	binding site for residue CUA O 301
070	AJ7	SOFTWARE	PHE N:321 , HIS N:328 , ILE O:41 , HIS O:52 , MET O:56 , ASP O:57 , TRP O:65 , GLU R:6 , THR R:7 , ASP R:8 , ARG V:10 , HOH V:256	binding site for residue PSC O 302
071	AJ8	SOFTWARE	TYR N:447 , ALA O:2 , GLN O:10 , LEU O:136 , PRO O:166 , TYR O:193 , HOH O:440 , HOH O:505	binding site for residue EDO O 303
072	AJ9	SOFTWARE	GLU O:157 , HOH O:432 , HOH O:436 , EDO P:307	binding site for residue EDO O 304
073	AK1	SOFTWARE	PGV G:104 , HIS N:233 , ASP N:300 , THR N:301 , TYR N:304 , HOH N:744 , TRP P:99 , HIS P:103 , HOH P:484	binding site for residue CHD P 301
074	AK2	SOFTWARE	HIS N:151 , PGV N:609 , TRP P:34 , TYR P:181 , TYR P:182 , ALA P:184 , PHE P:186 , THR P:187 , ILE P:188 , PHE P:198 , HOH P:404 , HOH P:545 , TRP T:62 , THR T:68 , PHE T:69 , PHE T:70 , HIS T:71 , ASN T:76 , HOH T:232	binding site for residue PEK P 302
075	AK3	SOFTWARE	ILE B:67 , CHD B:304 , LYS P:157 , HIS P:158 , GLN P:161 , THR P:168 , TYR P:172 , HOH P:431 , HOH P:530 , ALA S:1 , EDO S:104 , ARG T:17 , PHE T:21 , TRP T:36 , CDL T:102	binding site for residue PEK P 303
076	AK4	SOFTWARE	TRP P:58 , VAL P:61 , SER P:65 , THR P:66 , HIS P:71 , HIS P:207 , ILE P:210 , PHE P:214 , ARG P:221 , HIS P:226 , PHE P:227 , THR P:228 , HIS P:231 , HIS P:232 , PHE P:233 , GLY P:234 , CDL P:305 , HOH P:422 , HOH P:424 , HOH P:492 , HOH S:229	binding site for residue PGV P 304
077	AK5	SOFTWARE	MET P:51 , TYR P:55 , ARG P:59 , ILE P:62 , ARG P:63 , PHE P:67 , THR P:213 , PHE P:220 , LYS P:224 , HIS P:226 , PGV P:304 , HOH P:457 , HOH P:509 , HOH P:525 , HOH P:542 , LYS W:8	binding site for residue CDL P 305
078	AK6	SOFTWARE	ARG P:156 , LYS P:157 , LEU P:160 , GLN P:161 , PHE P:219 , LEU P:223	binding site for residue CHD P 306
079	AK7	SOFTWARE	GLY O:177 , EDO O:304 , HOH O:436 , GLU P:111 , HOH P:417 , HOH P:456 , HOH P:465	binding site for residue EDO P 307
080	AK8	SOFTWARE	CHD W:101	binding site for residue EDO P 308
081	AK9	SOFTWARE	HIS P:243	binding site for residue EDO P 309
082	AL1	SOFTWARE	TRP N:334 , MET N:339 , LEU N:342 , ALA N:415 , HOH N:714 , LEU O:39 , ILE O:42 , THR O:47 , HOH O:538 , ARG Q:73 , SER Q:74 , GLU Q:77 , TRP Q:78 , HOH Q:334 , HOH Q:335 , HOH Q:402 , ARG V:16 , EDO V:101	binding site for residue TGL Q 201
083	AL2	SOFTWARE	ARG R:14 , TYR R:18	binding site for residue EDO R 201
084	AL3	SOFTWARE	TYR R:18 , LYS R:21 , GLU R:28 , HOH R:301	binding site for residue EDO R 202
085	AL4	SOFTWARE	CYS S:60 , CYS S:62 , CYS S:82 , CYS S:85	binding site for residue ZN S 101
086	AL5	SOFTWARE	THR N:490 , EDO N:611 , SER S:67 , VAL S:69 , TRP S:71 , HOH S:234 , HOH S:241 , HOH S:249	binding site for residue EDO S 102
087	AL6	SOFTWARE	HIS P:231 , HOH P:496 , ASP S:9 , GLU S:17 , HOH S:211 , HOH S:248	binding site for residue EDO S 103
088	AL7	SOFTWARE	CHD B:304 , ASP F:65 , PEK P:303 , ALA S:1	binding site for residue EDO S 104
089	AL8	SOFTWARE	THR C:95 , PHE C:98 , VAL C:247 , SER T:2 , ALA T:3 , LYS T:5 , GLY T:6 , ASP T:7 , HIS T:8 , CDL T:102 , HOH T:249	binding site for residue PEK T 101
090	AL9	SOFTWARE	ASP A:300 , TYR A:304 , SER A:307 , ILE A:311 , EDO A:615 , HOH A:890 , ALA B:70 , ALA B:77 , LEU B:78 , LEU B:81 , TYR B:85 , HOH B:520 , PGV C:305 , ASN P:125 , LEU P:127 , LEU P:131 , VAL P:142 , PEK P:303 , SER T:27 , LEU T:30 , CYS T:31 , ASN T:34 , LEU T:37 , HIS T:38 , PEK T:101 , HOH T:260	binding site for residue CDL T 102
091	AM1	SOFTWARE	HOH P:545 , TRP T:62 , GLY T:63 , HOH T:207 , HOH T:236	binding site for residue DMU T 103
092	AM2	SOFTWARE	GLY P:120 , ALA T:46 , PHE T:47 , ILE T:48 , LEU T:53 , ARG T:54 , HOH T:222	binding site for residue EDO T 104
093	AM3	SOFTWARE	TGL Q:201 , ARG V:16 , HIS V:20 , HOH V:201 , HOH V:214	binding site for residue EDO V 101
094	AM4	SOFTWARE	ILE N:3 , EDO P:308 , TYR W:32 , ARG W:33 , THR W:37 , LEU W:40 , HOH W:243	binding site for residue CHD W 101
095	AM5	SOFTWARE	LEU N:110 , SER P:29 , SER W:46 , HOH W:201	binding site for residue EDO W 102
096	AM6	SOFTWARE	MET N:423	binding site for residue EDO X 101
097	AM7	SOFTWARE	THR N:17 , LEU N:18 , PHE N:22 , TRP N:25 , TRP N:81 , LEU N:113 , PHE N:400 , ILE Y:11 , PRO Y:12 , PHE Y:13 , SER Y:14 , ARG Y:20 , MET Y:24 , MET Y:25 , PHE Y:28 , PHE Y:29 , HOH Y:228 , HOH Y:234	binding site for residue TGL Y 101
098	AM8	SOFTWARE	TRP Q:98 , LEU Z:27 , LEU Z:28 , GLY Z:31 , TRP Z:32 , TYR Z:35 , HIS Z:36 , HOH Z:206	binding site for residue DMU Z 101
099	AM9	SOFTWARE	ILE N:3 , ASN N:4 , ARG N:5 , TRP N:6 , HOH N:807 , HOH N:913 , HOH N:921 , TYR Y:3 , PRO Y:12	binding site for Di-peptide FME N 1 and PHE N 2
100	AN1	SOFTWARE	TRP N:236 , PHE N:238 , GLY N:239 , PRO N:241 , GLU N:242 , VAL N:243 , ILE N:245 , LEU N:246 , ILE N:247 , LEU N:248 , ILE N:280 , GLY N:284 , VAL N:287 , HIS N:290 , HIS N:291 , ILE N:312 , HEA N:602 , CU N:603 , CMO N:606	binding site for Di-peptide HIS N 240 and TYR N 244
101	AN2	SOFTWARE	SER N:434 , ALA N:446 , TYR N:447 , TYR O:3 , GLN O:6 , GLN O:10 , LEU O:133 , TYR O:193 , EDO O:303 , HOH O:505 , HOH O:547	binding site for Di-peptide FME O 1 and ALA O 2
102	AN3	SOFTWARE	HOH R:386 , ALA V:3 , LEU V:4 , HOH V:217 , HOH V:234 , HOH V:239	binding site for Di-peptide SAC V 1 and THR V 2

SS Bonds (4, 4)

Cis Peptide Bonds (8, 8)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (11, 22)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:514
 aligned with COX1_BOVIN | P00396 from UniProtKB/Swiss-Prot  Length:514

    Alignment length:514
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510    
           COX1_BOVIN     1 MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK 514
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhh......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhh..............ee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5b3s A   1 mFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK 514
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510    
                            |                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 
                            1-FME

Chain B from PDB  Type:PROTEIN  Length:227
 aligned with COX2_BOVIN | P68530 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:227
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       
           COX2_BOVIN     1 MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML 227
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeeee..eeeeee.....eeeee...hhhhh.............eeee....eeeeeee....eeeeehhhheeeee.....eeeee.....eeeeee.......hhhh.eeeeeeehhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5b3s B   1 mAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML 227
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       
                            1-FME

Chain C from PDB  Type:PROTEIN  Length:259
 aligned with COX3_BOVIN | P00415 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:259
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252         
           COX3_BOVIN     3 HQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS 261
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5b3s C   3 HQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS 261
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252

Chain D from PDB  Type:PROTEIN  Length:144
 aligned with COX41_BOVIN | P00423 from UniProtKB/Swiss-Prot  Length:169

    Alignment length:144
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165    
          COX41_BOVIN    26 SVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK 169
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhh......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh.......hhh.ee....ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5b3s D   4 SVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK 147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143

Chain E from PDB  Type:PROTEIN  Length:105
 aligned with COX5A_BOVIN | P00426 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:105
                                    57        67        77        87        97       107       117       127       137       147     
          COX5A_BOVIN    48 HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV 152
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh...hhhhhhhhhhhhh......hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 3 (1) Exon 3.2  PDB: E:5-32       ----------------------------------------Exon 3.4  PDB: E:73-109               Transcript 3 (1)
           Transcript 3 (2) ---------------------------Exon 3.3  PDB: E:32-72 UniProt: 75-115   ------------------------------------- Transcript 3 (2)
                 5b3s E   5 HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV 109
                                    14        24        34        44        54        64        74        84        94       104

Chain F from PDB  Type:PROTEIN  Length:94
 aligned with COX5B_BOVIN | P00428 from UniProtKB/Swiss-Prot  Length:129

    Alignment length:94
                                    41        51        61        71        81        91       101       111       121    
          COX5B_BOVIN    32 ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH 125
               SCOP domains ---------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhh....................eeeee...eeeeee.........eeeeee....ee......eeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------- Transcript
                 5b3s F   1 ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH  94
                                    10        20        30        40        50        60        70        80        90

Chain G from PDB  Type:PROTEIN  Length:84
 aligned with CX6A2_BOVIN | P07471 from UniProtKB/Swiss-Prot  Length:97

    Alignment length:84
                                    22        32        42        52        62        72        82        92    
          CX6A2_BOVIN    13 ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK  96
               SCOP domains ------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhhhhhhhhhhhhhhhhh.............................................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------ PROSITE
           Transcript 4 (1) Exon 4.1     ---------------------------------------------Exon 4.3  PDB: G:59-84     Transcript 4 (1)
           Transcript 4 (2) ------------Exon 4.2  PDB: G:13-58 UniProt: 25-70         -------------------------- Transcript 4 (2)
                 5b3s G   1 ASAAKGDHGGtGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK  84
                                    10|       20        30        40        50        60        70        80    
                                     11-TPO

Chain H from PDB  Type:PROTEIN  Length:79
 aligned with CX6B1_BOVIN | P00429 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:79
                                    17        27        37        47        57        67        77         
          CX6B1_BOVIN     8 KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI  86
               SCOP domains ------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------- Transcript
                 5b3s H   7 KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI  85
                                    16        26        36        46        56        66        76

Chain I from PDB  Type:PROTEIN  Length:73
 aligned with COX6C_BOVIN | P04038 from UniProtKB/Swiss-Prot  Length:74

    Alignment length:73
                                    11        21        31        41        51        61        71   
          COX6C_BOVIN     2 STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK  74
               SCOP domains ------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: I:1-36 UniProt: 1-37 Exon 1.3  PDB: I:37-73 UniProt: 38-74 Transcript 1
                 5b3s I   1 xTALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK  73
                            |       10        20        30        40        50        60        70   
                            1-SAC

Chain J from PDB  Type:PROTEIN  Length:58
 aligned with CX7A1_BOVIN | P07470 from UniProtKB/Swiss-Prot  Length:80

    Alignment length:58
                                    31        41        51        61        71        
          CX7A1_BOVIN    22 FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHK  79
               SCOP domains ---------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh.....hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.2     Exon 2.3  PDB: J:14-42       ---------------- Transcript 2 (1)
           Transcript 2 (2) -----------------------------------------Exon 2.4          Transcript 2 (2)
                 5b3s J   1 FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHK  58
                                    10        20        30        40        50

Chain K from PDB  Type:PROTEIN  Length:49
 aligned with COX7B_BOVIN | P13183 from UniProtKB/Swiss-Prot  Length:80

    Alignment length:49
                                    39        49        59        69         
          COX7B_BOVIN    30 APDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWR  78
               SCOP domains ------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------- Transcript
                 5b3s K   6 APDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWR  54
                                    15        25        35        45

Chain L from PDB  Type:PROTEIN  Length:46
 aligned with COX7C_BOVIN | P00430 from UniProtKB/Swiss-Prot  Length:63

    Alignment length:46
                                    27        37        47        57      
          COX7C_BOVIN    18 HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK  63
               SCOP domains ---------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------- PROSITE
                 Transcript ---------------------------------------------- Transcript
                 5b3s L   2 HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK  47
                                    11        21        31        41

Chain M from PDB  Type:PROTEIN  Length:43
 aligned with COX8B_BOVIN | P10175 from UniProtKB/Swiss-Prot  Length:70

    Alignment length:43
                                    34        44        54        64   
          COX8B_BOVIN    25 ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKS  67
               SCOP domains ------------------------------------------- SCOP domains
               CATH domains ------------------------------------------- CATH domains
               Pfam domains ------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------- PROSITE
                 Transcript ------------------------------------------- Transcript
                 5b3s M   1 ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKS  43
                                    10        20        30        40

Chain N from PDB  Type:PROTEIN  Length:514
 aligned with COX1_BOVIN | P00396 from UniProtKB/Swiss-Prot  Length:514

    Alignment length:514
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510    
           COX1_BOVIN     1 MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK 514
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhh.....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee..hhhhhhhhh..............ee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5b3s N   1 mFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK 514
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510    
                            1-FME

Chain O from PDB  Type:PROTEIN  Length:227
 aligned with COX2_BOVIN | P68530 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:227
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       
           COX2_BOVIN     1 MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML 227
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeeee..eeeeee.....eeeee...hhhhh.............eeee....eeeeeee....eeeeehhhheeeee.....eeeee.....eeeeee.......hhhh.eeeeeeehhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5b3s O   1 mAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML 227
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       
                            1-FME

Chain P from PDB  Type:PROTEIN  Length:259
 aligned with COX3_BOVIN | P00415 from UniProtKB/Swiss-Prot  Length:261

    Alignment length:259
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252         
           COX3_BOVIN     3 HQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS 261
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5b3s P   3 HQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS 261
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252

Chain Q from PDB  Type:PROTEIN  Length:144
 aligned with COX41_BOVIN | P00423 from UniProtKB/Swiss-Prot  Length:169

    Alignment length:144
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165    
          COX41_BOVIN    26 SVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK 169
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhhhh....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh.......hhh.ee....ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5b3s Q   4 SVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK 147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143

Chain R from PDB  Type:PROTEIN  Length:105
 aligned with COX5A_BOVIN | P00426 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:105
                                    57        67        77        87        97       107       117       127       137       147     
          COX5A_BOVIN    48 HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV 152
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh...hhhhhhhhhhhhh......hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 3 (1) Exon 3.2  PDB: R:5-32       ----------------------------------------Exon 3.4  PDB: R:73-109               Transcript 3 (1)
           Transcript 3 (2) ---------------------------Exon 3.3  PDB: R:32-72 UniProt: 75-115   ------------------------------------- Transcript 3 (2)
                 5b3s R   5 HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV 109
                                    14        24        34        44        54        64        74        84        94       104

Chain S from PDB  Type:PROTEIN  Length:94
 aligned with COX5B_BOVIN | P00428 from UniProtKB/Swiss-Prot  Length:129

    Alignment length:94
                                    41        51        61        71        81        91       101       111       121    
          COX5B_BOVIN    32 ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH 125
               SCOP domains ---------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhh....................eeeee...eeeeee.........eeeeee....ee......eeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------- Transcript
                 5b3s S   1 ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH  94
                                    10        20        30        40        50        60        70        80        90

Chain T from PDB  Type:PROTEIN  Length:84
 aligned with CX6A2_BOVIN | P07471 from UniProtKB/Swiss-Prot  Length:97

    Alignment length:84
                                    22        32        42        52        62        72        82        92    
          CX6A2_BOVIN    13 ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK  96
               SCOP domains ------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhhhhhhhhhhhhhhh................................................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------ PROSITE
           Transcript 4 (1) Exon 4.1     ---------------------------------------------Exon 4.3  PDB: T:59-84     Transcript 4 (1)
           Transcript 4 (2) ------------Exon 4.2  PDB: T:13-58 UniProt: 25-70         -------------------------- Transcript 4 (2)
                 5b3s T   1 ASAAKGDHGGtGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK  84
                                    10|       20        30        40        50        60        70        80    
                                     11-TPO

Chain U from PDB  Type:PROTEIN  Length:79
 aligned with CX6B1_BOVIN | P00429 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:79
                                    17        27        37        47        57        67        77         
          CX6B1_BOVIN     8 KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI  86
               SCOP domains ------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------- Transcript
                 5b3s U   7 KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI  85
                                    16        26        36        46        56        66        76

Chain V from PDB  Type:PROTEIN  Length:73
 aligned with COX6C_BOVIN | P04038 from UniProtKB/Swiss-Prot  Length:74

    Alignment length:73
                                    11        21        31        41        51        61        71   
          COX6C_BOVIN     2 STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK  74
               SCOP domains ------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.2  PDB: V:1-36 UniProt: 1-37 Exon 1.3  PDB: V:37-73 UniProt: 38-74 Transcript 1
                 5b3s V   1 xTALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK  73
                            |       10        20        30        40        50        60        70   
                            1-SAC

Chain W from PDB  Type:PROTEIN  Length:58
 aligned with CX7A1_BOVIN | P07470 from UniProtKB/Swiss-Prot  Length:80

    Alignment length:58
                                    31        41        51        61        71        
          CX7A1_BOVIN    22 FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHK  79
               SCOP domains ---------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhh....hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.2     Exon 2.3  PDB: W:14-42       ---------------- Transcript 2 (1)
           Transcript 2 (2) -----------------------------------------Exon 2.4          Transcript 2 (2)
                 5b3s W   1 FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHK  58
                                    10        20        30        40        50

Chain X from PDB  Type:PROTEIN  Length:49
 aligned with COX7B_BOVIN | P13183 from UniProtKB/Swiss-Prot  Length:80

    Alignment length:49
                                    39        49        59        69         
          COX7B_BOVIN    30 APDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWR  78
               SCOP domains ------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------- Transcript
                 5b3s X   6 APDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWR  54
                                    15        25        35        45

Chain Y from PDB  Type:PROTEIN  Length:46
 aligned with COX7C_BOVIN | P00430 from UniProtKB/Swiss-Prot  Length:63

    Alignment length:46
                                    27        37        47        57      
          COX7C_BOVIN    18 HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK  63
               SCOP domains ---------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------- PROSITE
                 Transcript ---------------------------------------------- Transcript
                 5b3s Y   2 HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK  47
                                    11        21        31        41

Chain Z from PDB  Type:PROTEIN  Length:43
 aligned with COX8B_BOVIN | P10175 from UniProtKB/Swiss-Prot  Length:70

    Alignment length:43
                                    34        44        54        64   
          COX8B_BOVIN    25 ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKS  67
               SCOP domains ------------------------------------------- SCOP domains
               CATH domains ------------------------------------------- CATH domains
               Pfam domains ------------------------------------------- Pfam domains
         Sec.struct. author .ee.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------- PROSITE
                 Transcript ------------------------------------------- Transcript
                 5b3s Z   1 ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKS  43
                                    10        20        30        40

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (32, 127)

Asymmetric Unit(hide GO term definitions)

Chain A,N (COX1_BOVIN | P00396)

molecular function
	GO:0004129	cytochrome-c oxidase activity	Catalysis of the reaction: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0009060	aerobic respiration	The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which requires oxygen as the terminal electron acceptor.
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006119	oxidative phosphorylation	The phosphorylation of ADP to ATP that accompanies the oxidation of a metabolite through the operation of the respiratory chain. Oxidation of compounds establishes a proton gradient across the membrane, providing the energy for ATP synthesis.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.
	GO:0045277	respiratory chain complex IV	A part of the respiratory chain, containing the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).

Chain B,O (COX2_BOVIN | P68530)

molecular function
	GO:0005507	copper ion binding	Interacting selectively and non-covalently with copper (Cu) ions.
	GO:0004129	cytochrome-c oxidase activity	Catalysis of the reaction: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0022900	electron transport chain	A process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.
	GO:0045277	respiratory chain complex IV	A part of the respiratory chain, containing the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).

Chain C,P (COX3_BOVIN | P00415)

molecular function
	GO:0004129	cytochrome-c oxidase activity	Catalysis of the reaction: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
	GO:0015002	heme-copper terminal oxidase activity	Catalysis of the four-electron reduction of dioxygen (O2) to water, coupled to generation of a proton electrochemical gradient across a membrane.
biological process
	GO:0019646	aerobic electron transport chain	A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to oxygen to generate a transmembrane electrochemical gradient.
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
	GO:0008535	respiratory chain complex IV assembly	The aggregation, arrangement and bonding together of a set of components to form respiratory chain complex IV (also known as cytochrome c oxidase), the terminal member of the respiratory chain of the mitochondrion and some aerobic bacteria. Cytochrome c oxidases are multi-subunit enzymes containing from 13 subunits in the mammalian mitochondrial form to 3-4 subunits in the bacterial forms.
	GO:0022904	respiratory electron transport chain	A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0045277	respiratory chain complex IV	A part of the respiratory chain, containing the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).

Chain D,Q (COX41_BOVIN | P00423)

molecular function
	GO:0004129	cytochrome-c oxidase activity	Catalysis of the reaction: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
biological process
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
	GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	The transfer of electrons from cytochrome c to oxygen that occurs during oxidative phosphorylation, mediated by the multisubunit enzyme known as complex IV.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0031966	mitochondrial membrane	Either of the lipid bilayers that surround the mitochondrion and form the mitochondrial envelope.
	GO:0005751	mitochondrial respiratory chain complex IV	A protein complex located in the mitochondrial inner membrane that forms part of the mitochondrial respiratory chain. Contains the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0045277	respiratory chain complex IV	A part of the respiratory chain, containing the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).

Chain E,R (COX5A_BOVIN | P00426)

molecular function
	GO:0004129	cytochrome-c oxidase activity	Catalysis of the reaction: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
	GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	The transfer of electrons from cytochrome c to oxygen that occurs during oxidative phosphorylation, mediated by the multisubunit enzyme known as complex IV.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005751	mitochondrial respiratory chain complex IV	A protein complex located in the mitochondrial inner membrane that forms part of the mitochondrial respiratory chain. Contains the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0043209	myelin sheath	An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
	GO:0045277	respiratory chain complex IV	A part of the respiratory chain, containing the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).

Chain F,S (COX5B_BOVIN | P00428)

molecular function
	GO:0004129	cytochrome-c oxidase activity	Catalysis of the reaction: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005740	mitochondrial envelope	The double lipid bilayer enclosing the mitochondrion and separating its contents from the cell cytoplasm; includes the intermembrane space.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0045277	respiratory chain complex IV	A part of the respiratory chain, containing the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).

Chain G,T (CX6A2_BOVIN | P07471)

molecular function
	GO:0004129	cytochrome-c oxidase activity	Catalysis of the reaction: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
biological process
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005751	mitochondrial respiratory chain complex IV	A protein complex located in the mitochondrial inner membrane that forms part of the mitochondrial respiratory chain. Contains the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0045277	respiratory chain complex IV	A part of the respiratory chain, containing the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).

Chain H,U (CX6B1_BOVIN | P00429)

molecular function
	GO:0004129	cytochrome-c oxidase activity	Catalysis of the reaction: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
biological process
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
cellular component
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005758	mitochondrial intermembrane space	The region between the inner and outer lipid bilayers of the mitochondrial envelope.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0045277	respiratory chain complex IV	A part of the respiratory chain, containing the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).

Chain I,V (COX6C_BOVIN | P04038)

molecular function
	GO:0004129	cytochrome-c oxidase activity	Catalysis of the reaction: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
biological process
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0045277	respiratory chain complex IV	A part of the respiratory chain, containing the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).

Chain J,W (CX7A1_BOVIN | P07470)

molecular function
	GO:0004129	cytochrome-c oxidase activity	Catalysis of the reaction: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
biological process
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005746	mitochondrial respiratory chain	The protein complexes that form the mitochondrial electron transport system (the respiratory chain), associated with the inner mitochondrial membrane. The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0045277	respiratory chain complex IV	A part of the respiratory chain, containing the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).

Chain K,X (COX7B_BOVIN | P13183)

molecular function
	GO:0004129	cytochrome-c oxidase activity	Catalysis of the reaction: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
biological process
	GO:0007417	central nervous system development	The process whose specific outcome is the progression of the central nervous system over time, from its formation to the mature structure. The central nervous system is the core nervous system that serves an integrating and coordinating function. In vertebrates it consists of the brain and spinal cord. In those invertebrates with a central nervous system it typically consists of a brain, cerebral ganglia and a nerve cord.
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005746	mitochondrial respiratory chain	The protein complexes that form the mitochondrial electron transport system (the respiratory chain), associated with the inner mitochondrial membrane. The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0045277	respiratory chain complex IV	A part of the respiratory chain, containing the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).

Chain L,Y (COX7C_BOVIN | P00430)

molecular function
	GO:0004129	cytochrome-c oxidase activity	Catalysis of the reaction: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
biological process
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0045277	respiratory chain complex IV	A part of the respiratory chain, containing the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).

Chain M,Z (COX8B_BOVIN | P10175)

molecular function
	GO:0004129	cytochrome-c oxidase activity	Catalysis of the reaction: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
biological process
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
	GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	The transfer of electrons from cytochrome c to oxygen that occurs during oxidative phosphorylation, mediated by the multisubunit enzyme known as complex IV.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005751	mitochondrial respiratory chain complex IV	A protein complex located in the mitochondrial inner membrane that forms part of the mitochondrial respiratory chain. Contains the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0045277	respiratory chain complex IV	A part of the respiratory chain, containing the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2).

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (18, 110)

Sites (102, 102)

SS Bonds (4, 4)

Cis Peptide Bonds (8, 8)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (11, 22)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (32, 127)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File