Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF A CARBOXAMINE COMPOUND (26) (2-{2-[(CYCLOPROPYLCARBONYL) AMINO]PYRIDIN-4-YL}-4-METHOXYPYRIMIDINE-5-CARBOXAMIDE) TO GSK3B
 
Authors :  H. A. Lewis, P. Sivaprakasam, K. Kish, M. Pokross, G. M. Dubowchik
Date :  10 Mar 14  (Deposition) - 08 Apr 15  (Release) - 10 Jun 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.36
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Serine/Threonine Kinase, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  P. Sivaprakasam, X. Han, R. L. Civiello, S. Jacutin-Porte, K. Kish, M. Pokross, H. A. Lewis, N. Ahmed, N. Szapiel, J. A. Newitt, E. T. Baldwin, H. Xiao, C. M. Krause, H. Park, M. Nophsker, J. S. Lippy, C. R. Burton, D. R. Langley, J. E. Macor, G. M. Dubowchik
Discovery Of New Acylaminopyridines As Gsk-3 Inhibitors By Structure Guided In-Depth Exploration Of Chemical Space Around A Pyrrolopyridinone Core.
Bioorg. Med. Chem. Lett. V. 25 1856 2015
PubMed-ID: 25845281  |  Reference-DOI: 10.1016/J.BMCL.2015.03.046

(-) Compounds

Molecule 1 - GLYCOGEN SYNTHASE KINASE-3 BETA
    ChainsA, B
    EC Number2.7.11.26, 2.7.11.1
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Taxid7108
    GeneGSK3B
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymGSK-3 BETA, SERINE/THREONINE-PROTEIN KINASE GSK3B

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
12WG2Ligand/Ion2-{2-[(CYCLOPROPYLCARBONYL)AMINO]PYRIDIN-4-YL}-4-METHOXYPYRIMIDINE-5-CARBOXAMIDE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
12WG1Ligand/Ion2-{2-[(CYCLOPROPYLCARBONYL)AMINO]PYRIDIN-4-YL}-4-METHOXYPYRIMIDINE-5-CARBOXAMIDE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
12WG1Ligand/Ion2-{2-[(CYCLOPROPYLCARBONYL)AMINO]PYRIDIN-4-YL}-4-METHOXYPYRIMIDINE-5-CARBOXAMIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPHE A:67 , VAL A:70 , ALA A:83 , LYS A:85 , LEU A:132 , ASP A:133 , TYR A:134 , VAL A:135 , PRO A:136 , ARG A:141 , LEU A:188 , ASP A:200 , HOH A:650BINDING SITE FOR RESIDUE 2WG A 501
2AC2SOFTWAREPHE B:67 , ALA B:83 , LYS B:85 , LEU B:132 , ASP B:133 , TYR B:134 , VAL B:135 , PRO B:136 , ARG B:141 , LEU B:188 , ASP B:200BINDING SITE FOR RESIDUE 2WG B 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4PTG)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4PTG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4PTG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4PTG)

(-) Exons   (0, 0)

(no "Exon" information available for 4PTG)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:333
                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee.......eeeeeeeeeeeee...eeeeeeee.....eeeeeeee......hhhhhhhhh........eeeeeee..eeeeeee...eehhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh..ee....hhh.eeee....eeee......ee.................hhhhhh......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh..hhhhhhhh.......hhhhh.....hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhh.................hhhhhh.hhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ptg A  36 KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHA 382
                                    45        55        65        75        85        95       105       115  ||   131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281  ||   299       309       319       329       339       349       359       369       379   
                                                                                                            118|                                                                                                                                                            284|                                                                                         
                                                                                                             125                                                                                                                                                             293                                                                                         

Chain B from PDB  Type:PROTEIN  Length:332
                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.......eeeeeeeeeeeee...eeeeeeee.....eeeeeeee......hhhhhhhh.........eeeeeee....eeeeeee...eehhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh..ee....hhh.eeee....eeee......ee.................hhhhhh......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh..hhhhhhhh...hhhhh....hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhh.................hhhhhh.hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ptg B  37 VTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQ 385
                                    46        56        66        76        86        96       106       116  ||   130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280   ||  303       313       323       333       343       353       363       373       383  
                                                                                                            119|                                                                                                                                                             284|                                                                                       
                                                                                                             124                                                                                                                                                              298                                                                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4PTG)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4PTG)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4PTG)

(-) Gene Ontology  (146, 146)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2WG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4ptg)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4ptg
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GSK3B_HUMAN | P49841
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
  2.7.11.26
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GSK3B_HUMAN | P49841
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GSK3B_HUMAN | P498411gng 1h8f 1i09 1j1b 1j1c 1o6k 1o6l 1o9u 1pyx 1q3d 1q3w 1q41 1q4l 1q5k 1r0e 1uv5 2jdo 2jdr 2jld 2o5k 2ow3 2uw9 2x39 2xh5 3cqu 3cqw 3du8 3e87 3e88 3e8d 3f7z 3f88 3gb2 3i4b 3l1s 3m1s 3mv5 3ow4 3pup 3q3b 3qkk 3say 3sd0 3zdi 3zrk 3zrl 3zrm 4acc 4acd 4acg 4ach 4afj 4b7t 4dit 4ekk 4iq6 4j1r 4j71 4nm0 4nm3 4nm5 4nm7 4ptc 4pte 5f94 5f95 5hln 5hlp 5k5n

(-) Related Entries Specified in the PDB File

4ptc 4pte