Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  GSK-3BETA WITH INHIBITOR 6-CHLORO-N-CYCLOHEXYL-4-(1H-PYRROLO[2,3-B]PYRIDIN-3-YL)PYRIDIN-2-AMINE
 
Authors :  Y. Tong, K. D. Stewart, A. S. Florjancic, J. E. Harlan, P. J. Merta, M. Przytulinska, N. Soni, K. S. Swinger, H. Zhu, E. F. Johnson, A. R. Sho T. D. Penning
Date :  10 Jan 13  (Deposition) - 24 Apr 13  (Release) - 24 Sep 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.12
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Protein Kinase, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Tong, K. D. Stewart, A. S. Florjancic, J. E. Harlan, P. J. Merta, M. Przytulinska, N. Soni, K. K. Swinger, H. Zhu, E. F. Johnson, A. R. Shoemaker, T. D. Penning
Azaindole-Based Inhibitors Of Cdc7 Kinase: Impact Of The Pre-Dfg Residue, Val 195.
Acs Med Chem Lett V. 4 211 2013
PubMed-ID: 24900653  |  Reference-DOI: 10.1021/ML300348C

(-) Compounds

Molecule 1 - GLYCOGEN SYNTHASE KINASE-3 BETA
    Chains: A, B
    EC Number: 2.7.11.26, 2.7.11.1
    Engineered: YES
    Expression System: BACULOVIRUS
    Expression System Strain: HIGH FIVE
    Expression System Taxid: 7108
    Gene: GSK3B
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: GSK-3 BETA, SERINE/THREONINE-PROTEIN KINASE GSK3B

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1IQ62Ligand/Ion6-CHLORO-N-CYCLOHEXYL-4-(1H-PYRROLO[2,3-B]PYRIDIN-3-YL)PYRIDIN-2-AMINE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1IQ61Ligand/Ion6-CHLORO-N-CYCLOHEXYL-4-(1H-PYRROLO[2,3-B]PYRIDIN-3-YL)PYRIDIN-2-AMINE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1IQ61Ligand/Ion6-CHLORO-N-CYCLOHEXYL-4-(1H-PYRROLO[2,3-B]PYRIDIN-3-YL)PYRIDIN-2-AMINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE A:62 , GLY A:63 , PHE A:67 , ALA A:83 , LYS A:85 , GLU A:97 , ASP A:133 , TYR A:134 , VAL A:135 , LEU A:188 , CYS A:199 , ASP A:200BINDING SITE FOR RESIDUE IQ6 A 501
2AC2SOFTWAREPHE B:67 , ALA B:83 , LYS B:85 , GLU B:97 , MET B:101 , ASP B:133 , TYR B:134 , VAL B:135 , GLN B:185 , LEU B:188 , CYS B:199 , ASP B:200BINDING SITE FOR RESIDUE IQ6 B 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4IQ6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4IQ6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4IQ6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4IQ6)

(-) Exons   (0, 0)

(no "Exon" information available for 4IQ6)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:324
                                                                                                                                                                                                                                                                                                                                                                    
               SCOP domains d4iq6a_ A: Glycogen synthase kinase-3 beta (Gsk3b)                                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeee.......eeeeeeeeeeeee....eeeeeee.....eeeeeee.......hhhhhhhhhh.......eeeee...eeeeee...eehhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh..ee....hhh.eee......eee......ee.................hhhhhh......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh..hhhhhhhhh..........hhhhhhhhhhhh........hhhhhhhhhhhhhh...................hhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4iq6 A  37 VTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHA 382
                                    46        56        66        76        86        96       106       116 ||    134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284||     308       318       328       338       348       358       368       378    
                                                                                                           118|                                                                                                                                                           285|                                                                                  
                                                                                                            127                                                                                                                                                            300                                                                                  


Chain B from PDB  Type:PROTEIN  Length:332
                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains d4iq6b_ B: Glycogen synthase kinase-3 beta (Gsk3b)                                                                                                                                                                                                                                                                                           SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.......eeeeeeeeeeee.....eeeeeee.....eeeeeeee......hhhhhhhhhh.......eeeeeee..eeeeeee...eehhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh..ee....hhh.eee......eee.hhhhhee.................hhhhhh......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh..hhhhhhh........hhhhhh....hhhhhhhhhhhh........hhhhhhhhhhhhhh...................hhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4iq6 B  37 VTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHA 382
                                    46        56        66        76        86        96       106       116  ||   132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282 ||    300       310       320       330       340       350       360       370       380  
                                                                                                            119|                                                                                                                                                           284|                                                                                         
                                                                                                             126                                                                                                                                                            293
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4IQ6)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4IQ6)

(-) Gene Ontology  (146, 146)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    IQ6  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4iq6)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4iq6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GSK3B_HUMAN | P49841
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
  2.7.11.26
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GSK3B_HUMAN | P49841
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GSK3B_HUMAN | P49841: 1gng 1h8f 1i09 1j1b 1j1c 1o6k 1o6l 1o9u 1pyx 1q3d 1q3w 1q41 1q4l 1q5k 1r0e 1uv5 2jdo 2jdr 2jld 2o5k 2ow3 2uw9 2x39 2xh5 3cqu 3cqw 3du8 3e87 3e88 3e8d 3f7z 3f88 3gb2 3i4b 3l1s 3m1s 3mv5 3ow4 3pup 3q3b 3qkk 3say 3sd0 3zdi 3zrk 3zrl 3zrm 4acc 4acd 4acg 4ach 4afj 4b7t 4dit 4ekk 4j1r 4j71 4nm0 4nm3 4nm5 4nm7 4ptc 4pte 4ptg 5f94 5f95 5hln 5hlp 5k5n

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4IQ6)