Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  ANTHRANILATE PHOSPHORIBOSYL TRANSFERASE FROM MYCOBACTERIUM TUBERCULOSIS IN COMPLEX WITH 6-FLUOROANTHRANILATE, PRPP AND MAGNESIUM
 
Authors :  A. Castell, T. V. M. Cookson, F. L. Short, J. S. Lott
Date :  03 Feb 14  (Deposition) - 23 Apr 14  (Release) - 17 Dec 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.99
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Anthranilic Acids, Magnesium, Tryptophan, Inhibitor, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. V. Cookson, A. Castell, E. M. Bulloch, G. L. Evans, F. L. Short, E. N. Baker, J. S. Lott, E. J. Parker
Alternative Substrates Reveal Catalytic Cycle And Key Binding Events In The Reaction Catalysed By Anthranilate Phosphoribosyltransferase From Mycobacterium Tuberculosis.
Biochem. J. V. 461 87 2014
PubMed-ID: 24712732  |  Reference-DOI: 10.1042/BJ20140209

(-) Compounds

Molecule 1 - ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE
    Chains: A, B
    EC Number: 2.4.2.18
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET23A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector: PLASMID
    Expression System Vector Type: PLASMID
    Gene: MT2248,MTCY190.03C,RV2192C,TRPD
    Organism Scientific: MYCOBACTERIUM TUBERCULOSIS
    Organism Taxid: 1773

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 14)

Asymmetric/Biological Unit (5, 14)
No.NameCountTypeFull Name
16F04Ligand/Ion2-AZANYL-6-FLUORANYL-BENZOIC ACID
2GOL3Ligand/IonGLYCEROL
3IMD1Ligand/IonIMIDAZOLE
4MG4Ligand/IonMAGNESIUM ION
5PRP2Ligand/IonALPHA-PHOSPHORIBOSYLPYROPHOSPHORIC ACID

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:251 , GLU A:252 , MG A:402 , PRP A:403 , HOH A:678 , HOH A:738 , HOH A:739 , HOH A:740binding site for residue MG A 401
02AC2SOFTWARESER A:119 , GLU A:252 , MG A:401 , PRP A:403 , HOH A:678 , HOH A:726binding site for residue MG A 402
03AC3SOFTWAREVAL A:106 , GLY A:107 , GLY A:109 , GLY A:110 , ASN A:117 , SER A:119 , THR A:120 , LYS A:135 , ASN A:138 , ALA A:140 , ALA A:141 , SER A:142 , SER A:143 , GLY A:146 , GLY A:147 , GLU A:252 , MG A:401 , MG A:402 , 6F0 A:405 , HOH A:601 , HOH A:676 , HOH A:678 , HOH A:726 , HOH A:735 , HOH A:740binding site for residue PRP A 403
04AC4SOFTWAREASN A:138 , HIS A:183 , TYR A:186 , ALA A:190 , ARG A:194binding site for residue 6F0 A 404
05AC5SOFTWAREVAL A:106 , GLY A:107 , THR A:108 , HIS A:136 , ASN A:138 , ALA A:179 , ARG A:193 , GLY A:206 , PRP A:403 , HOH A:592binding site for residue 6F0 A 405
06AC6SOFTWAREPHE A:274 , ASP A:275 , GLY A:278 , TRP A:336 , HOH A:528binding site for residue GOL A 406
07AC7SOFTWAREARG A:42 , ALA A:170 , GLU A:171 , GLY A:173 , ARG A:362 , HOH A:505binding site for residue GOL A 407
08AC8SOFTWARESER B:119 , GLU B:252 , MG B:402 , PRP B:403 , HOH B:597 , HOH B:603binding site for residue MG B 401
09AC9SOFTWAREASP B:251 , GLU B:252 , MG B:401 , PRP B:403 , HOH B:597 , HOH B:652 , HOH B:728 , HOH B:738binding site for residue MG B 402
10AD1SOFTWAREVAL B:106 , GLY B:107 , GLY B:109 , GLY B:110 , ASN B:117 , SER B:119 , THR B:120 , LYS B:135 , ASN B:138 , ALA B:140 , ALA B:141 , SER B:142 , SER B:143 , GLY B:146 , GLY B:147 , GLU B:252 , MG B:401 , MG B:402 , 6F0 B:405 , HOH B:597 , HOH B:603 , HOH B:638 , HOH B:648 , HOH B:652 , HOH B:674 , HOH B:700 , HOH B:735binding site for residue PRP B 403
11AD2SOFTWAREASN B:138 , ALA B:179 , HIS B:183 , TYR B:186 , ARG B:187 , ALA B:190 , ARG B:194binding site for residue 6F0 B 404
12AD3SOFTWAREVAL B:106 , GLY B:107 , THR B:108 , HIS B:136 , ASN B:138 , ALA B:179 , ARG B:193 , GLY B:206 , PRP B:403 , HOH B:620 , HOH B:731binding site for residue 6F0 B 405
13AD4SOFTWARELEU B:305 , GLY B:306 , GLY B:307 , ILE B:351 , ASP B:352 , GLY B:354 , GLU B:357 , HOH B:503binding site for residue GOL B 406
14AD5SOFTWAREASP A:275 , GLY A:278 , ARG B:302binding site for residue IMD B 407

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4OWO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4OWO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4OWO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4OWO)

(-) Exons   (0, 0)

(no "Exon" information available for 4OWO)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:348
                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhh......hhhhhhhhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.............eeeee.........hhhhhhhhhhhhh...eeeee........hhhhhhhhh......hhhhhhhhhhhhheeeeehhhhh..hhhhhhhhhhhh..hhhhhhhhhh......eeeee.....hhhhhhhhhhh...eeeeeee............eeeeeee..eeeeeeehhhhhh....hhhhhh..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4owo A  23 SVPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI 370
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362        


Chain B from PDB  Type:PROTEIN  Length:349
                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh......hhhhhhhhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.............eeeee.........hhhhhhhhhhhhh...eeeee........hhhhhhhhh......hhhhhhhhhhhhheeeeehhhhh..hhhhhhhhhhhh..hhhhhhhhhh......eeeee.....hhhhhhhhhhhh..eeeeeee............eeeeeee..eeeeeeehhhhhh....hhhhhh..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4owo B  24 VPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQILE 372
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4OWO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4OWO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4OWO)

(-) Gene Ontology  (14, 23)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    6F0  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IMD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PRP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4owo)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4owo
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TRPD_MYCTO | P9WFX4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  TRPD_MYCTU | P9WFX5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.4.2.18
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TRPD_MYCTO | P9WFX4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TRPD_MYCTU | P9WFX5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TRPD_MYCTO | P9WFX4: 1zvw 2bpq 3qqs 3qr9 3qs8 3qsa 3r6c 3r88 3twp 3uu1 4giu 4gkm 4ij1 4m0r 4n5v 4n8q 4n93 4owm 4own 4owq 4ows 4owu 4owv
        TRPD_MYCTU | P9WFX5: 1zvw 2bpq 3qqs 3qr9 3qs8 3qsa 3r6c 3r88 3twp 3uu1 4giu 4gkm 4ij1 4m0r 4n5v 4n8q 4n93 4owm 4own 4owq 4ows 4owu 4owv 4x58 4x59 4x5a 4x5b 4x5c 4x5d 4x5e 5bne 5byt 5c1r 5c2l 5c7s

(-) Related Entries Specified in the PDB File

4owm 4own 4owq 4ows 4owu 4owv