Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE VARIANT P180A FROM MYCOBACTERIUM TUBERCULOSIS IN COMPLEX WITH PRPP AND MG
 
Authors :  T. V. M. Cookson, G. L. Evans, E. J. Parker, J. S. Lott
Date :  04 Dec 14  (Deposition) - 25 Nov 15  (Release) - 25 Nov 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Anthranilate Phosphoribosyltransferase, Anthranilic Acids, Mycobacterium Tuberculosis, Magnesium, Tryptophan, Mutation, Transferase, Magnesium Binding, Phosphoribosyl Pyrophosphate (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. V. Cookson, G. L. Evans, A. Castell, E. N. Baker, J. S. Lott, E. J. Parker
Structures Of Mycobacterium Tuberculosis Anthranilate Phosphoribosyltransferase Variants Reveal The Conformationa Changes That Facilitate Delivery Of The Substrate To The Active Site.
Biochemistry V. 54 6082 2015
PubMed-ID: 26356348  |  Reference-DOI: 10.1021/ACS.BIOCHEM.5B00612

(-) Compounds

Molecule 1 - ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE
    Chains: A, B
    EC Number: 2.4.2.18
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET23A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: TRPD
    Mutation: YES
    Organism Scientific: MYCOBACTERIUM TUBERCULOSIS
    Organism Taxid: 1773

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 12)

Asymmetric/Biological Unit (4, 12)
No.NameCountTypeFull Name
1GOL6Ligand/IonGLYCEROL
2IMD2Ligand/IonIMIDAZOLE
3MG2Ligand/IonMAGNESIUM ION
4PRP2Ligand/IonALPHA-PHOSPHORIBOSYLPYROPHOSPHORIC ACID

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREVAL A:106 , GLY A:107 , THR A:108 , GLY A:109 , ASN A:114 , THR A:115 , VAL A:116 , SER A:119 , LYS A:135 , SER A:145 , GLY A:146 , GLY A:147 , ASP A:251 , GLU A:252 , HOH A:585binding site for residue PRP A 401
02AC2SOFTWAREALA A:236 , ARG A:237 , ARG A:238 , LEU A:305 , GLY A:307 , ILE A:351 , ASP A:352 , GLU A:357binding site for residue GOL A 402
03AC3SOFTWAREPHE A:274 , ASP A:275 , GLY A:278 , TRP A:336binding site for residue GOL A 403
04AC4SOFTWAREVAL B:106 , GLY B:107 , THR B:108 , GLY B:109 , GLY B:110 , ASN B:117 , SER B:119 , THR B:120 , LYS B:135 , ASN B:138 , ALA B:141 , SER B:142 , SER B:143 , GLY B:146 , GLY B:147 , GLU B:252 , MG B:402 , MG B:403 , HOH B:627 , HOH B:628 , HOH B:629 , HOH B:634 , HOH B:640 , HOH B:644binding site for residue PRP B 401
05AC5SOFTWARESER B:119 , GLU B:252 , PRP B:401 , MG B:403 , HOH B:627 , HOH B:628binding site for residue MG B 402
06AC6SOFTWAREASP B:251 , GLU B:252 , PRP B:401 , MG B:402 , HOH B:628 , HOH B:629 , HOH B:630 , HOH B:631binding site for residue MG B 403
07AC7SOFTWARETRP B:47 , ARG B:346 , GOL B:408binding site for residue IMD B 404
08AC8SOFTWAREARG B:237 , LEU B:305 , GLY B:306 , GLY B:307 , ILE B:351 , ASP B:352 , GLU B:357binding site for residue IMD B 405
09AC9SOFTWAREARG B:238 , ALA B:265 , ALA B:266 , GLY B:329binding site for residue GOL B 406
10AD1SOFTWAREARG B:263 , VAL B:325 , GLY B:329 , ALA B:334 , TRP B:336 , HOH B:567binding site for residue GOL B 407
11AD2SOFTWAREASP B:50 , SER B:88 , HIS B:89 , ARG B:345 , ARG B:346 , IMD B:404 , HOH B:529binding site for residue GOL B 408
12AD3SOFTWAREVAL B:156 , ARG B:157 , LEU B:160 , SER B:168 , TRP B:363 , PHE B:366 , GLY B:367 , HOH B:556 , HOH B:581binding site for residue GOL B 409

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4X59)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4X59)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4X59)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4X59)

(-) Exons   (0, 0)

(no "Exon" information available for 4X59)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:344
                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh......hhhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh............eeeee....hhhhhhhhhhhhhhh...eeeee........hhhhhhhhh......hhhhhhhhhhhhheeeeehhhhh..hhhhhhhhhhhh..hhhhhhhhhh......eeeee.....hhhhhhhhhhhh..eeeeeee............eeeeeee..eeeeeeehhhhhh....hhhhh...hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x59 A  24 VPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAARFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI 370
                                    33        43        53        63        73        83        93       103      |116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366    
                                                                                                                110|                                                                                                                                                                                                                                                                
                                                                                                                 114                                                                                                                                                                                                                                                                


Chain B from PDB  Type:PROTEIN  Length:347
                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh......hhhhhhhhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh............eeeee.........hhhhhhhhhhhhh...eeeee........hhhhhhhhh......hhhhhhhhhhhhheeeeehhhhh..hhhhhhhhhhhh..hhhhhhhhhh......eeeee.....hhhhhhhhhhhh..eeeeeee............eeeeeee..eeeeeeehhhhhh....hhhhhh..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x59 B  24 VPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAARFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI 370
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4X59)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4X59)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4X59)

(-) Gene Ontology  (14, 23)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IMD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PRP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4x59)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4x59
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TRPD_MYCTA | A5U4M0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  TRPD_MYCTU | P9WFX5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.4.2.18
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TRPD_MYCTA | A5U4M0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TRPD_MYCTU | P9WFX5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TRPD_MYCTA | A5U4M0: 4x58 4x5a 4x5b 4x5c 4x5d 4x5e 4zof 4zoj 4zok 4ztv 5bo2 5bo3
        TRPD_MYCTU | P9WFX5: 1zvw 2bpq 3qqs 3qr9 3qs8 3qsa 3r6c 3r88 3twp 3uu1 4giu 4gkm 4ij1 4m0r 4n5v 4n8q 4n93 4owm 4own 4owo 4owq 4ows 4owu 4owv 4x58 4x5a 4x5b 4x5c 4x5d 4x5e 5bne 5byt 5c1r 5c2l 5c7s

(-) Related Entries Specified in the PDB File

4x58 4x5a 4x5b 4x5c 4x5d 4x5e