Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CO-CRYSTAL STRUCTURE OF THE PPIASE DOMAIN OF FKBP51, RAPAMYCIN AND THE FRB FRAGMENT OF MTOR
 
Authors :  A. M. Maerz, A. Bracher, F. Hausch
Date :  17 Feb 12  (Deposition) - 06 Feb 13  (Release) - 27 Mar 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.45
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Fk-506 Binding Domain, Hsp90 Cochaperone, Immunophilin, Peptidyl- Prolyl Isomerase, Mammalian Target Of Rapamycin, Kinase, Signalling, Immunosuppression, Cancer, Isomerase-Transferase Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. M. Marz, A. K. Fabian, C. Kozany, A. Bracher, F. Hausch
Large Fk506-Binding Proteins Shape The Pharmacology Of Rapamycin.
Mol. Cell. Biol. V. 33 1357 2013
PubMed-ID: 23358420  |  Reference-DOI: 10.1128/MCB.00678-12

(-) Compounds

Molecule 1 - PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP5
    ChainsA
    EC Number5.2.1.8
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPPROEX-HTA
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentFKBP51 FK1 DOMAIN, UNP RESIDUES 1-140
    GeneAIG6, FKBP5, FKBP51
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPPIASE FKBP5, 51 KDA FK506-BINDING PROTEIN, 51 KDA FKBP, FKBP-51, 54 KDA PROGESTERONE RECEPTOR-ASSOCIATED IMMUNOPHILIN, ANDROGEN-REGULATED PROTEIN 6, FF1 ANTIGEN, FK506-BINDING PROTEIN 5, FKBP-5, FKBP54, P54, HSP90-BINDING IMMUNOPHILIN, ROTAMASE
 
Molecule 2 - SERINE/THREONINE-PROTEIN KINASE MTOR
    ChainsB
    EC Number2.7.11.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPPROEX-HTA
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentFRB DOMAIN, UNP RESIDUES 2025-2114
    GeneFRAP, FRAP1, FRAP2, MTOR, RAFT1, RAPT1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymFK506-BINDING PROTEIN 12-RAPAMYCIN COMPLEX-ASSOCIATED PROTEIN 1, FKBP12-RAPAMYCIN COMPLEX-ASSOCIATED PROTEIN, MAMMALIAN TARGET OF RAPAMYCIN, MTOR, MECHANISTIC TARGET OF RAPAMYCIN, RAPAMYCIN AND FKBP12 TARGET 1, RAPAMYCIN TARGET PROTEIN 1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1RAP1Ligand/IonRAPAMYCIN IMMUNOSUPPRESSANT DRUG

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:57 , PHE A:67 , ASP A:68 , ARG A:73 , PHE A:77 , GLY A:84 , GLN A:85 , VAL A:86 , ILE A:87 , TRP A:90 , TYR A:113 , ILE A:122 , PHE A:130 , HOH A:316 , HOH A:353 , HOH A:366 , HOH A:386 , LEU B:2031 , GLU B:2032 , SER B:2035 , PHE B:2039 , THR B:2098 , ASP B:2102 , TYR B:2105 , PHE B:2108 , HOH B:2219BINDING SITE FOR RESIDUE RAP A 201

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4DRI)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Leu A:119 -Pro A:120

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

Asymmetric/Biological Unit (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_041542M2011VMTOR_HUMANUnclassified  ---BD2020V

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FKBP_PPIASEPS50059 FKBP-type peptidyl-prolyl cis-trans isomerase domain profile.FKBP5_HUMAN50-138
165-251
  1A:50-138
-

(-) Exons   (7, 7)

Asymmetric/Biological Unit (7, 7)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.3bENST000003572663bENSE00001519071chr6:35656719-35656581139FKBP5_HUMAN-00--
1.4aENST000003572664aENSE00001370159chr6:35610620-35610497124FKBP5_HUMAN1-35351A:20-3516
1.5ENST000003572665ENSE00000747346chr6:35604935-35604791145FKBP5_HUMAN36-84491A:36-8449
1.6ENST000003572666ENSE00001391213chr6:35588051-35587909143FKBP5_HUMAN84-131481A:84-13148
1.7ENST000003572667ENSE00000747342chr6:35586987-35586873115FKBP5_HUMAN132-170391A:132-1409
1.8ENST000003572668ENSE00000747340chr6:35565181-35565025157FKBP5_HUMAN170-222530--
1.9ENST000003572669ENSE00000747304chr6:35558997-3555890791FKBP5_HUMAN222-252310--
1.10aENST0000035726610aENSE00000747303chr6:35554894-3555481184FKBP5_HUMAN253-280280--
1.11ENST0000035726611ENSE00000747302chr6:35547998-35547813186FKBP5_HUMAN281-342620--
1.12ENST0000035726612ENSE00000747301chr6:35545010-35544771240FKBP5_HUMAN343-422800--
1.13bENST0000035726613bENSE00001193215chr6:35543719-355413622358FKBP5_HUMAN423-457350--

2.1ENST000003614451ENSE00001471842chr1:11322564-1132250263MTOR_HUMAN-00--
2.2ENST000003614452ENSE00000818899chr1:11319480-11319305176MTOR_HUMAN1-54540--
2.3ENST000003614453ENSE00000743816chr1:11318650-11318542109MTOR_HUMAN55-91370--
2.4ENST000003614454ENSE00000743815chr1:11317222-11316990233MTOR_HUMAN91-168780--
2.5ENST000003614455ENSE00000743814chr1:11316249-11316049201MTOR_HUMAN169-235670--
2.6ENST000003614456ENSE00000743813chr1:11314030-11313896135MTOR_HUMAN236-280450--
2.7ENST000003614457ENSE00000743812chr1:11308151-11307876276MTOR_HUMAN281-372920--
2.8ENST000003614458ENSE00000743810chr1:11307790-11307682109MTOR_HUMAN373-409370--
2.9ENST000003614459ENSE00000743807chr1:11303357-11303171187MTOR_HUMAN409-471630--
2.10ENST0000036144510ENSE00000743805chr1:11301738-11301610129MTOR_HUMAN471-514440--
2.11ENST0000036144511ENSE00000743803chr1:11300604-11300360245MTOR_HUMAN514-596830--
2.12ENST0000036144512ENSE00000743801chr1:11298674-11298459216MTOR_HUMAN596-668730--
2.13ENST0000036144513ENSE00000743799chr1:11298105-11297900206MTOR_HUMAN668-736690--
2.14ENST0000036144514ENSE00000743796chr1:11294322-11294200123MTOR_HUMAN737-777410--
2.15ENST0000036144515ENSE00000743794chr1:11293544-1129345590MTOR_HUMAN778-807300--
2.16ENST0000036144516ENSE00000743792chr1:11292585-1129249393MTOR_HUMAN808-838310--
2.17ENST0000036144517ENSE00000743790chr1:11291491-11291357135MTOR_HUMAN839-883450--
2.18ENST0000036144518ENSE00000743788chr1:11291111-11290982130MTOR_HUMAN884-927440--
2.19ENST0000036144519ENSE00000743785chr1:11288975-11288725251MTOR_HUMAN927-1010840--
2.20ENST0000036144520ENSE00000743783chr1:11276291-1127620587MTOR_HUMAN1011-1039290--
2.21ENST0000036144521ENSE00000743781chr1:11273623-11273456168MTOR_HUMAN1040-1095560--
2.22ENST0000036144522ENSE00000743779chr1:11272965-11272853113MTOR_HUMAN1096-1133380--
2.23ENST0000036144523ENSE00000743777chr1:11272531-11272369163MTOR_HUMAN1133-1187550--
2.24ENST0000036144524ENSE00000743775chr1:11270963-1127087193MTOR_HUMAN1188-1218310--
2.25ENST0000036144525ENSE00001435329chr1:11269515-11269369147MTOR_HUMAN1219-1267490--
2.26ENST0000036144526ENSE00000743771chr1:11264760-11264618143MTOR_HUMAN1268-1315480--
2.27ENST0000036144527ENSE00000743769chr1:11259760-11259598163MTOR_HUMAN1315-1369550--
2.28ENST0000036144528ENSE00000743767chr1:11259460-11259315146MTOR_HUMAN1370-1418490--
2.29ENST0000036144529ENSE00001167981chr1:11227574-1122749976MTOR_HUMAN1418-1443260--
2.30ENST0000036144530ENSE00001167973chr1:11217348-11217209140MTOR_HUMAN1444-1490470--
2.31ENST0000036144531ENSE00001167966chr1:11210283-11210183101MTOR_HUMAN1490-1524350--
2.32ENST0000036144532ENSE00001167960chr1:11206848-11206733116MTOR_HUMAN1524-1562390--
2.33aENST0000036144533aENSE00001167950chr1:11205102-1120502578MTOR_HUMAN1563-1588260--
2.33cENST0000036144533cENSE00001167940chr1:11204812-11204705108MTOR_HUMAN1589-1624360--
2.34bENST0000036144534bENSE00001167929chr1:11199715-11199590126MTOR_HUMAN1625-1666420--
2.35aENST0000036144535aENSE00001167919chr1:11199492-11199361132MTOR_HUMAN1667-1710440--
2.36ENST0000036144536ENSE00001167913chr1:11194523-11194408116MTOR_HUMAN1711-1749390--
2.37aENST0000036144537aENSE00001167905chr1:11193254-11193137118MTOR_HUMAN1749-1788400--
2.38bENST0000036144538bENSE00001167893chr1:11190834-11190586249MTOR_HUMAN1789-1871830--
2.39ENST0000036144539ENSE00001041990chr1:11189895-11189795101MTOR_HUMAN1872-1905340--
2.40ENST0000036144540ENSE00001167869chr1:11189008-1118891297MTOR_HUMAN1905-1937330--
2.41ENST0000036144541ENSE00001167858chr1:11188609-1118851199MTOR_HUMAN1938-1970330--
2.42ENST0000036144542ENSE00001167852chr1:11188183-11188061123MTOR_HUMAN1971-2011411B:2017-20204
2.43ENST0000036144543ENSE00001167844chr1:11187863-11187681183MTOR_HUMAN2012-2072611B:2021-2072 (gaps)61
2.44ENST0000036144544ENSE00001167837chr1:11187201-11187067135MTOR_HUMAN2073-2117451B:2073-211240
2.45ENST0000036144545ENSE00001167829chr1:11186853-11186679175MTOR_HUMAN2118-2176590--
2.46ENST0000036144546ENSE00001167821chr1:11184690-11184555136MTOR_HUMAN2176-2221460--
2.47ENST0000036144547ENSE00001167814chr1:11182183-11182036148MTOR_HUMAN2221-2270500--
2.48ENST0000036144548ENSE00001167809chr1:11181425-11181303123MTOR_HUMAN2271-2311410--
2.49ENST0000036144549ENSE00001167801chr1:11177143-1117706183MTOR_HUMAN2312-2339280--
2.50cENST0000036144550cENSE00001167794chr1:11175525-1117545373MTOR_HUMAN2339-2363250--
2.51ENST0000036144551ENSE00001167789chr1:11174944-1117487075MTOR_HUMAN2364-2388250--
2.52bENST0000036144552bENSE00001065832chr1:11174510-11174375136MTOR_HUMAN2389-2434460--
2.53ENST0000036144553ENSE00001167772chr1:11172974-1117290966MTOR_HUMAN2434-2456230--
2.55ENST0000036144555ENSE00001167761chr1:11169786-1116970681MTOR_HUMAN2456-2483280--
2.56bENST0000036144556bENSE00001167749chr1:11169427-1116934781MTOR_HUMAN2483-2510280--
2.57ENST0000036144557ENSE00000818867chr1:11168343-11168238106MTOR_HUMAN2510-2545360--
2.58cENST0000036144558cENSE00001345243chr1:11167557-11166592966MTOR_HUMAN2545-254950--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:121
 aligned with FKBP5_HUMAN | Q13451 from UniProtKB/Swiss-Prot  Length:457

    Alignment length:121
                                    29        39        49        59        69        79        89        99       109       119       129       139 
         FKBP5_HUMAN     20 EQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE  140
               SCOP domains d4dria_ A: automated matches                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee........eeeeeee............eeeeeeeeee....eeee.hhhh..eeee......hhhhhhhhh......eeeeee.hhhh...............eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------FKBP_PPIASE  PDB: A:50-138 UniProt: 50-138                                               -- PROSITE
           Transcript 1 (1) Exon 1.4a       Exon 1.5  PDB: A:36-84 UniProt: 36-84            -----------------------------------------------Exon 1.7  Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------Exon 1.6  PDB: A:84-131 UniProt: 84-131         --------- Transcript 1 (2)
                4dri A   20 EQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE  140
                                    29        39        49        59        69        79        89        99       109       119       129       139 

Chain B from PDB  Type:PROTEIN  Length:96
 aligned with MTOR_HUMAN | P42345 from UniProtKB/Swiss-Prot  Length:2549

    Alignment length:105
                                  2017      2027      2037      2047      2057      2067      2077      2087      2097      2107     
          MTOR_HUMAN   2008 QAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS 2112
               SCOP domains d4dri  b_        B: automated matches                                                                     SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....--hhh-------hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---V----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 2 2.42Exon 2.43  PDB: B:2021-2072 (gaps) UniProt: 2012-2072        Exon 2.44  PDB: B:2073-2112 [INCOMPLETE] Transcript 2
                4dri B 2017 GAMDP--EFM-------EMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS 2112
                                | 2024      2027      2037      2047      2057      2067      2077      2087      2097      2107     
                             2021  | |    2025                                                                                       
                                2022 |                                                                                               
                                  2024                                                                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4DRI)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4DRI)

(-) Gene Ontology  (145, 151)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (FKBP5_HUMAN | Q13451)
molecular function
    GO:0005528    FK506 binding    Interacting selectively and non-covalently with the 23-membered macrolide lactone FK506.
    GO:0031072    heat shock protein binding    Interacting selectively and non-covalently with a heat shock protein, any protein synthesized or activated in response to heat shock.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0003755    peptidyl-prolyl cis-trans isomerase activity    Catalysis of the reaction: peptidyl-proline (omega=180) = peptidyl-proline (omega=0).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0061077    chaperone-mediated protein folding    The process of inhibiting aggregation and assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure that is dependent on interaction with a chaperone.
    GO:0006457    protein folding    The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
    GO:0000413    protein peptidyl-prolyl isomerization    The modification of a protein by cis-trans isomerization of a proline residue.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B   (MTOR_HUMAN | P42345)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0001030    RNA polymerase III type 1 promoter DNA binding    Interacting selectively and non-covalently with a region of DNA that is a part of a type 1 promoter that controls transcription by RNA polymerase III. Type 1 promoters are found in 5S rRNA genes, downstream of the transcription start site within the sequence of the mature RNA, and require TFIIIA for recognition.
    GO:0001031    RNA polymerase III type 2 promoter DNA binding    Interacting selectively and non-covalently with a region of DNA that is a part of a type 2 promoter that controls transcription by RNA polymerase III. Type 2 promoters consist of an A box and a B box downstream of the transcription start site within the sequence within the sequence of the mature RNA. Type 2 promoters are found in many tRNA genes as well as in other small RNAs.
    GO:0001032    RNA polymerase III type 3 promoter DNA binding    Interacting selectively and non-covalently with a region of DNA that is a part of a type 3 promoter that controls transcription by RNA polymerase III. A type 3 Pol III promoter is composed of elements upstream of the transcription start site, including a TATA box. The human U6 snRNA gene has a type 3 promoter. Type 3 Pol III promoters have not been observed in S. cerevisiae.
    GO:0001156    TFIIIC-class transcription factor binding    Interacting selectively and non-covalently with an RNA polymerase III transcription factor of the TFIIIC class, one of the factors involved in formation of the preinitiation complex (PIC) by RNA polymerase III.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0044877    macromolecular complex binding    Interacting selectively and non-covalently with any macromolecular complex.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0051219    phosphoprotein binding    Interacting selectively and non-covalently with a phosphorylated protein.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0043022    ribosome binding    Interacting selectively and non-covalently with any part of a ribosome.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006207    'de novo' pyrimidine nucleobase biosynthetic process    The chemical reactions and pathways resulting in the formation of pyrimidine nucleobases, 1,3-diazine, organic nitrogenous bases, beginning with the synthesis of a pyrimidine ring from simpler precursors.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0031295    T cell costimulation    The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
    GO:0031929    TOR signaling    A series of molecular signals mediated by TOR (Target of rapamycin) proteins, members of the phosphoinositide (PI) 3-kinase related kinase (PIKK) family that act as serine/threonine kinases in response to nutrient availability or growth factors.
    GO:0007420    brain development    The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
    GO:0055006    cardiac cell development    The process whose specific outcome is the progression of a cardiac cell over time, from its formation to the mature state. A cardiac cell is a cell that will form part of the cardiac organ of an individual.
    GO:0055013    cardiac muscle cell development    The process whose specific outcome is the progression of a cardiac muscle cell over time, from its formation to the mature state.
    GO:0060048    cardiac muscle contraction    Muscle contraction of cardiac muscle tissue.
    GO:0048738    cardiac muscle tissue development    The process whose specific outcome is the progression of cardiac muscle over time, from its formation to the mature structure.
    GO:0007569    cell aging    An aging process that has as participant a cell after a cell has stopped dividing. Cell aging may occur when a cell has temporarily stopped dividing through cell cycle arrest (GO:0007050) or when a cell has permanently stopped dividing, in which case it is undergoing cellular senescence (GO:0090398). May precede cell death (GO:0008219) and succeed cell maturation (GO:0048469).
    GO:0007050    cell cycle arrest    A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
    GO:0016049    cell growth    The process in which a cell irreversibly increases in size over time by accretion and biosynthetic production of matter similar to that already present.
    GO:0030030    cell projection organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a prolongation or process extending from a cell, e.g. a flagellum or axon.
    GO:0071456    cellular response to hypoxia    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
    GO:0031669    cellular response to nutrient levels    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus reflecting the presence, absence, or concentration of nutrients.
    GO:0006112    energy reserve metabolic process    The chemical reactions and pathways by which a cell derives energy from stored compounds such as fats or glycogen.
    GO:0007281    germ cell development    The process whose specific outcome is the progression of an immature germ cell over time, from its formation to the mature structure (gamete). A germ cell is any reproductive cell in a multicellular organism.
    GO:0040007    growth    The increase in size or mass of an entire organism, a part of an organism or a cell.
    GO:0003007    heart morphogenesis    The developmental process in which the heart is generated and organized. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0003179    heart valve morphogenesis    The process in which the structure of a heart valve is generated and organized.
    GO:0007616    long-term memory    The memory process that deals with the storage, retrieval and modification of information a long time (typically weeks, months or years) after receiving that information. This type of memory is typically dependent on gene transcription regulated by second messenger activation.
    GO:0048255    mRNA stabilization    Prevention of degradation of mRNA molecules. In the absence of compensating changes in other processes, the slowing of mRNA degradation can result in an overall increase in the population of active mRNA molecules.
    GO:0016236    macroautophagy    The major inducible pathway for the general turnover of cytoplasmic constituents in eukaryotic cells, it is also responsible for the degradation of active cytoplasmic enzymes and organelles during nutrient starvation. Macroautophagy involves the formation of double-membrane-bounded autophagosomes which enclose the cytoplasmic constituent targeted for degradation in a membrane-bounded structure. Autophagosomes then fuse with a lysosome (or vacuole) releasing single-membrane-bounded autophagic bodies that are then degraded within the lysosome (or vacuole). Though once thought to be a purely non-selective process, it appears that some types of macroautophagy, e.g. macropexophagy, macromitophagy, may involve selective targeting of the targets to be degraded.
    GO:0060135    maternal process involved in female pregnancy    A reproductive process occurring in the mother that allows an embryo or fetus to develop within it.
    GO:0035264    multicellular organism growth    The increase in size or mass of an entire multicellular organism, as opposed to cell growth.
    GO:0051534    negative regulation of NFAT protein import into nucleus    Any process that stops, prevents, or reduces the frequency, rate or extent of the movement of an NFAT protein from the cytoplasm to the nucleus.
    GO:0010507    negative regulation of autophagy    Any process that stops, prevents, or reduces the frequency, rate or extent of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm.
    GO:0045792    negative regulation of cell size    Any process that reduces cell size.
    GO:1904193    negative regulation of cholangiocyte apoptotic process    Any process that stops, prevents or reduces the frequency, rate or extent of cholangiocyte apoptotic process.
    GO:1904213    negative regulation of iodide transmembrane transport    Any process that stops, prevents or reduces the frequency, rate or extent of iodide transmembrane transport.
    GO:0016242    negative regulation of macroautophagy    Any process that stops, prevents, or reduces the frequency, rate or extent of macroautophagy.
    GO:0014736    negative regulation of muscle atrophy    Any process that stops, prevents, or reduces the frequency, rate, or extent of muscle atrophy.
    GO:0001933    negative regulation of protein phosphorylation    Any process that stops, prevents or reduces the rate of addition of phosphate groups to amino acids within a protein.
    GO:0031397    negative regulation of protein ubiquitination    Any process that stops, prevents, or reduces the frequency, rate or extent of the addition of ubiquitin groups to a protein.
    GO:0018105    peptidyl-serine phosphorylation    The phosphorylation of peptidyl-serine to form peptidyl-O-phospho-L-serine.
    GO:0018107    peptidyl-threonine phosphorylation    The phosphorylation of peptidyl-threonine to form peptidyl-O-phospho-L-threonine.
    GO:0048015    phosphatidylinositol-mediated signaling    A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0030838    positive regulation of actin filament polymerization    Any process that activates or increases the frequency, rate or extent of actin polymerization.
    GO:0010942    positive regulation of cell death    Any process that increases the rate or frequency of cell death. Cell death is the specific activation or halting of processes within a cell so that its vital functions markedly cease, rather than simply deteriorating gradually over time, which culminates in cell death.
    GO:0061051    positive regulation of cell growth involved in cardiac muscle cell development    Any process that increases the rate, frequency, or extent of the growth of a cardiac muscle cell, where growth contributes to the progression of the cell over time from its initial formation to its mature state.
    GO:1904056    positive regulation of cholangiocyte proliferation    Any process that activates or increases the frequency, rate or extent of cholangiocyte proliferation.
    GO:0060999    positive regulation of dendritic spine development    Any process that increases the rate, frequency, or extent of dendritic spine development, the process whose specific outcome is the progression of the dendritic spine over time, from its formation to the mature structure.
    GO:1904000    positive regulation of eating behavior    Any process that activates or increases the frequency, rate or extent of eating behavior.
    GO:0001938    positive regulation of endothelial cell proliferation    Any process that activates or increases the rate or extent of endothelial cell proliferation.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0060252    positive regulation of glial cell proliferation    Any process that activates or increases the rate or extent of glial cell proliferation.
    GO:1904197    positive regulation of granulosa cell proliferation    Any process that activates or increases the frequency, rate or extent of granulosa cell proliferation.
    GO:0010592    positive regulation of lamellipodium assembly    Any process that increases the rate, frequency or extent of the formation of a lamellipodium, a thin sheetlike extension of the surface of a migrating cell.
    GO:0046889    positive regulation of lipid biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of lipids.
    GO:0010831    positive regulation of myotube differentiation    Any process that activates, maintains or increases the frequency, rate or extent of myotube differentiation. Myotube differentiation is the process in which a relatively unspecialized cell acquires specialized features of a myotube cell. Myotubes are multinucleated cells that are formed when proliferating myoblasts exit the cell cycle, differentiate and fuse.
    GO:0050769    positive regulation of neurogenesis    Any process that activates or increases the frequency, rate or extent of neurogenesis, the origin and formation of neurons.
    GO:1901216    positive regulation of neuron death    Any process that activates or increases the frequency, rate or extent of neuron death.
    GO:0014042    positive regulation of neuron maturation    Any process that activates or increases the frequency, rate or extent of neuron maturation.
    GO:0010976    positive regulation of neuron projection development    Any process that increases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
    GO:0045429    positive regulation of nitric oxide biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of nitric oxide.
    GO:0048714    positive regulation of oligodendrocyte differentiation    Any process that activates or increases the frequency, rate or extent of oligodendrocyte differentiation.
    GO:0050731    positive regulation of peptidyl-tyrosine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
    GO:0051897    positive regulation of protein kinase B signaling    Any process that activates or increases the frequency, rate or extent of protein kinase B signaling, a series of reactions mediated by the intracellular serine/threonine kinase protein kinase B.
    GO:0001934    positive regulation of protein phosphorylation    Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
    GO:1904058    positive regulation of sensory perception of pain    Any process that activates or increases the frequency, rate or extent of sensory perception of pain.
    GO:1904206    positive regulation of skeletal muscle hypertrophy    Any process that activates or increases the frequency, rate or extent of skeletal muscle hypertrophy.
    GO:0048661    positive regulation of smooth muscle cell proliferation    Any process that activates or increases the rate or extent of smooth muscle cell proliferation.
    GO:0051496    positive regulation of stress fiber assembly    Any process that activates or increases the frequency, rate or extent of the assembly of a stress fiber, a bundle of microfilaments and other proteins found in fibroblasts.
    GO:0045945    positive regulation of transcription from RNA polymerase III promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase III promoter.
    GO:1901838    positive regulation of transcription of nuclear large rRNA transcript from RNA polymerase I promoter    Any process that activates or increases the frequency, rate or extent of transcription of nuclear large rRNA transcript from RNA polymerase I promoter.
    GO:0045727    positive regulation of translation    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
    GO:0009791    post-embryonic development    The process whose specific outcome is the progression of the organism over time, from the completion of embryonic development to the mature structure. See embryonic development.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0030163    protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0043087    regulation of GTPase activity    Any process that modulates the rate of GTP hydrolysis by a GTPase.
    GO:0032956    regulation of actin cytoskeleton organization    Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
    GO:0090335    regulation of brown fat cell differentiation    Any process that modulates the rate, frequency, or extent of brown fat cell differentiation. Brown fat cell differentiation is the process in which a relatively unspecialized cell acquires specialized features of a brown adipocyte, an animal connective tissue cell involved in adaptive thermogenesis. Brown adipocytes contain multiple small droplets of triglycerides and a high number of mitochondria.
    GO:0006109    regulation of carbohydrate metabolic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving carbohydrates.
    GO:0043610    regulation of carbohydrate utilization    Any process that modulates the frequency, rate or extent of carbohydrate utilization.
    GO:1900034    regulation of cellular response to heat    Any process that modulates the frequency, rate or extent of cellular response to heat.
    GO:0031998    regulation of fatty acid beta-oxidation    Any process that modulates the frequency, rate or extent of fatty acid bbeta-oxidation.
    GO:0005979    regulation of glycogen biosynthetic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of glycogen.
    GO:0090559    regulation of membrane permeability    Any process that modulates the frequency, rate or extent of the passage or uptake of molecules by a membrane.
    GO:0031641    regulation of myelination    Any process that modulates the frequency, rate or extent of the formation of a myelin sheath around nerve axons.
    GO:0045670    regulation of osteoclast differentiation    Any process that modulates the frequency, rate or extent of osteoclast differentiation.
    GO:0051896    regulation of protein kinase B signaling    Any process that modulates the frequency, rate or extent of protein kinase B signaling, a series of reactions mediated by the intracellular serine/threonine kinase protein kinase B.
    GO:0045859    regulation of protein kinase activity    Any process that modulates the frequency, rate or extent of protein kinase activity.
    GO:0032095    regulation of response to food    Any process that modulates the frequency, rate or extent of a response to a food stimulus.
    GO:0043200    response to amino acid    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups.
    GO:0042220    response to cocaine    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cocaine stimulus. Cocaine is a crystalline alkaloid obtained from the leaves of the coca plant.
    GO:0032868    response to insulin    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
    GO:0043278    response to morphine    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a morphine stimulus. Morphine is an opioid alkaloid, isolated from opium, with a complex ring structure.
    GO:0007584    response to nutrient    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nutrient stimulus.
    GO:0006950    response to stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a disturbance in organismal or cellular homeostasis, usually, but not necessarily, exogenous (e.g. temperature, humidity, ionizing radiation).
    GO:0031529    ruffle organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a ruffle, a projection at the leading edge of a crawling cell.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0035176    social behavior    Behavior directed towards society, or taking place between members of the same species. Occurs predominantly, or only, in individuals that are part of a group.
    GO:0021510    spinal cord development    The process whose specific outcome is the progression of the spinal cord over time, from its formation to the mature structure. The spinal cord primarily conducts sensory and motor nerve impulses between the brain and the peripheral nervous tissues.
    GO:0008542    visual learning    Any process in an organism in which a change in behavior of an individual occurs in response to repeated exposure to a visual cue.
    GO:0050882    voluntary musculoskeletal movement    The movement of an organism or part of an organism using mechanoreceptors, the nervous system, striated muscle and/or the skeletal system that can be controlled at will.
    GO:0042060    wound healing    The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0000139    Golgi membrane    The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
    GO:0016605    PML body    A class of nuclear body; they react against SP100 auto-antibodies (PML, promyelocytic leukemia); cells typically contain 10-30 PML bodies per nucleus; alterations in the localization of PML bodies occurs after viral infection.
    GO:0031931    TORC1 complex    A protein complex that contains at least TOR (target of rapamycin) and Raptor (regulatory-associated protein of TOR), or orthologs of, in complex with other signaling components. Mediates the phosphorylation and activation of S6K. In Saccharomyces, the complex contains Kog1p, Lst8p, Tco89p, and either Tor1p or Tor2p.
    GO:0031932    TORC2 complex    A protein complex that contains at least TOR (target of rapamycin) and Rictor (rapamycin-insensitive companion of TOR), or orthologs of, in complex with other signaling components. Mediates the phosphorylation and activation of PKB (also called AKT). In Saccharomyces, the complex contains Avo1p, Avo2p, Tsc11p, Lst8p, Bit61p, Slm1p, Slm2p, and Tor2p.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0030425    dendrite    A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
    GO:0012505    endomembrane system    A collection of membranous structures involved in transport within the cell. The main components of the endomembrane system are endoplasmic reticulum, Golgi bodies, vesicles, cell membrane and nuclear envelope. Members of the endomembrane system pass materials through each other or though the use of vesicles.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0005765    lysosomal membrane    The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
    GO:0005764    lysosome    A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
    GO:0032991    macromolecular complex    A stable assembly of two or more macromolecules, i.e. proteins, nucleic acids, carbohydrates or lipids, in which at least one component is a protein and the constituent parts function together.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005741    mitochondrial outer membrane    The outer, i.e. cytoplasm-facing, lipid bilayer of the mitochondrial envelope.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0043025    neuronal cell body    The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0031090    organelle membrane    A membrane that is one of the two lipid bilayers of an organelle envelope or the outermost membrane of single membrane bound organelle.
    GO:0005942    phosphatidylinositol 3-kinase complex    A protein complex capable of phosphatidylinositol 3-kinase activity and containing subunits of any phosphatidylinositol 3-kinase (PI3K) enzyme. These complexes are divided in three classes (called I, II and III) that differ for their presence across taxonomic groups and for the type of their constituents. Catalytic subunits of phosphatidylinositol 3-kinase enzymes are present in all 3 classes; regulatory subunits of phosphatidylinositol 3-kinase enzymes are present in classes I and III; adaptor proteins have been observed in class II complexes and may be present in other classes too.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    RAP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:119 - Pro A:120   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4dri
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FKBP5_HUMAN | Q13451
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  MTOR_HUMAN | P42345
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
  5.2.1.8
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FKBP5_HUMAN | Q13451
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MTOR_HUMAN | P42345
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FKBP5_HUMAN | Q134511kt0 3o5d 3o5e 3o5f 3o5g 3o5i 3o5j 3o5k 3o5l 3o5m 3o5o 3o5p 3o5q 3o5r 4drh 4drk 4drm 4drn 4dro 4drp 4drq 4jfi 4jfj 4jfk 4jfl 4jfm 4r0x 4tw6 4tw7 4tx0 4w9o 4w9p 4w9q 5bxj 5dit 5diu 5div
        MTOR_HUMAN | P423451aue 1fap 1nsg 2fap 2gaq 2npu 2rse 3fap 3jbz 4drh 4drj 4fap 4jsn 4jsp 4jsv 4jsx 4jt5 4jt6 5flc 5gpg 5h64

(-) Related Entries Specified in the PDB File

4drh 4drj