3SW0 - JenaLib

Asym./Biol. Unit

Asym./Biol. Unit - sites

collapse

expand

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Description

Title :   STRUCTURE OF THE C-TERMINAL REGION (MODULES 18-20) OF COMPLEMENT REGULATOR FACTOR H

Authors :   H. P. Morgan, M. Guariento, C. Q. Schmidt, P. N. Barlow, J. P. Hannan

Date :   13 Jul 11 (Deposition) - 14 Mar 12 (Release) - 13 Feb 13 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym./Biol. Unit : X

Keywords :   Innate Immune Response, Sushi Domains, Cofactor In The Inactivation Of C3B, C3B, Human Plasma, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. P. Morgan, H. D. Mertens, M. Guariento, C. Q. Schmidt, D. C. Soares, D. I. Svergun, A. P. Herbert, P. N. Barlow, J. P. Hannan
Structural Analysis Of The C-Terminal Region (Modules 18-20 Of Complement Regulator Factor H (Fh).
Plos One V. 7 32187 2012
PubMed-ID: 22389686 | Reference-DOI: 10.1371/JOURNAL.PONE.0032187

Compounds

Molecule 1 - COMPLEMENT FACTOR H
	Chains	:	X
	Engineered	:	YES
	Expression System	:	PICHIA PASTORIS
	Expression System Taxid	:	4922
	Expression System Vector Type	:	PPICZ B
	Fragment	:	UNP RESIDUES 1046-1231
	Gene	:	CFH, HF, HF1, HF2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	H FACTOR 1

Structural Features

Chains, Units

		1
Asymmetric/Biological Unit	:	X

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (2, 5)

Asymmetric/Biological Unit (2, 5)

No.	Name	Count	Type	Full Name
1	GOL	4	Ligand/Ion	GLYCEROL
2	PO4	1	Ligand/Ion	PHOSPHATE ION

Sites (5, 5)

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HOH X:22 , HOH X:175 , HOH X:176 , ASN X:1095 , TRP X:1096 , THR X:1097 , GLY X:1194	BINDING SITE FOR RESIDUE GOL X 1
2	AC2	SOFTWARE	HOH X:41 , HOH X:63 , SER X:1079 , GLN X:1137 , CYS X:1138 , GLN X:1139 , ASN X:1140 , LEU X:1141 , TYR X:1142 , ARG X:1192	BINDING SITE FOR RESIDUE GOL X 2
3	AC3	SOFTWARE	HOH X:11 , HOH X:17 , HOH X:204 , ARG X:1062 , GLN X:1063 , PHE X:1123	BINDING SITE FOR RESIDUE GOL X 3
4	AC4	SOFTWARE	LYS X:1103 , ASP X:1104 , GLY X:1107 , ASN X:1154 , GLY X:1155	BINDING SITE FOR RESIDUE GOL X 4
5	AC5	SOFTWARE	LEU X:1125 , VAL X:1127 , TYR X:1128 , ALA X:1129 , SER X:1132	BINDING SITE FOR RESIDUE PO4 X 1232

SS Bonds (6, 6)

Asymmetric/Biological Unit

No.	Residues
1	X:1048	-	X:1091
2	X:1077	-	X:1102
3	X:1109	-	X:1152
4	X:1138	-	X:1163
5	X:1167	-	X:1218
6	X:1201	-	X:1228

Cis Peptide Bonds (1, 1)

Asymmetric/Biological Unit

No.	Residues
1	Ser X:1079	-	Pro X:1080

Sequence-Structure Mapping

SAPs(SNPs)/Variants (25, 25)

Asymmetric/Biological Unit (25, 25)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_025096	N	1050	Y	CFAH_HUMAN	Polymorphism	35274867	X	N	1050	Y
02	UniProt	VAR_025097	I	1059	T	CFAH_HUMAN	Polymorphism	35343172	X	I	1059	T
03	UniProt	VAR_025873	Q	1076	E	CFAH_HUMAN	Disease (CFHD)	---	X	Q	1076	E
04	UniProt	VAR_043895	R	1078	S	CFAH_HUMAN	Unclassified	---	X	R	1078	S
05	UniProt	VAR_025874	D	1119	G	CFAH_HUMAN	Disease (CFHD)	---	X	D	1119	G
06	UniProt	VAR_025875	V	1134	G	CFAH_HUMAN	Disease (AHUS1)	---	X	V	1134	G
07	UniProt	VAR_025876	Y	1142	D	CFAH_HUMAN	Disease (AHUS1)	---	X	Y	1142	D
08	UniProt	VAR_043896	Q	1143	E	CFAH_HUMAN	Polymorphism	34247141	X	Q	1143	E
09	UniProt	VAR_025877	W	1157	R	CFAH_HUMAN	Disease (AHUS1)	---	X	W	1157	R
10	UniProt	VAR_025878	C	1163	W	CFAH_HUMAN	Disease (AHUS1)	---	X	C	1163	W
11	UniProt	VAR_063650	I	1169	L	CFAH_HUMAN	Disease (AHUS1)	---	X	I	1169	L
12	UniProt	VAR_063651	W	1183	C	CFAH_HUMAN	Disease (AHUS1)	---	X	W	1183	C
13	UniProt	VAR_025879	W	1183	L	CFAH_HUMAN	Disease (AHUS1)	---	X	W	1183	L
14	UniProt	VAR_025880	W	1183	R	CFAH_HUMAN	Disease (AHUS1)	---	X	W	1183	R
15	UniProt	VAR_025881	T	1184	R	CFAH_HUMAN	Disease (CFHD)	---	X	T	1184	R
16	UniProt	VAR_019407	L	1189	R	CFAH_HUMAN	Disease (AHUS1)	---	X	L	1189	R
17	UniProt	VAR_019408	S	1191	L	CFAH_HUMAN	Disease (AHUS1)	460897	X	S	1191	L
18	UniProt	VAR_025882	G	1194	D	CFAH_HUMAN	Disease (AHUS1)	---	X	G	1194	D
19	UniProt	VAR_025883	V	1197	A	CFAH_HUMAN	Disease (AHUS1)	460184	X	V	1197	A
20	UniProt	VAR_025884	E	1198	A	CFAH_HUMAN	Disease (AHUS1)	---	X	E	1198	A
21	UniProt	VAR_031986	F	1199	S	CFAH_HUMAN	Disease (AHUS1)	---	X	F	1199	S
22	UniProt	VAR_025885	R	1210	C	CFAH_HUMAN	Disease (ARMD4)	---	X	R	1210	C
23	UniProt	VAR_025886	R	1215	G	CFAH_HUMAN	Disease (AHUS1)	---	X	R	1215	G
24	UniProt	VAR_025887	R	1215	Q	CFAH_HUMAN	Disease (CFHD)	---	X	R	1215	Q
25	UniProt	VAR_025888	P	1226	S	CFAH_HUMAN	Disease (AHUS1)	---	X	P	1226	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 3)

Asymmetric/Biological Unit (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SUSHI	PS50923	Sushi/CCP/SCR domain profile.	CFAH_HUMAN	19-82 83-143 144-207 208-264 265-322 387-444 446-507 515-566 567-625 628-686 689-746 751-805 809-866 868-928 929-986 987-1045 1046-1104 1107-1165 1194-1230	3	- - - - - - - - - - - - - - - - X:1046-1104 X:1107-1165 X:1194-1230

Exons (4, 4)

Asymmetric/Biological Unit (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000367429	1a	ENSE00001444484	chr1:196621008-196621305	298	CFAH_HUMAN	1-20	20	0	-	-
1.2a	ENST00000367429	2a	ENSE00001134426	chr1:196642108-196642293	186	CFAH_HUMAN	20-82	63	0	-	-
1.3	ENST00000367429	3	ENSE00000791013	chr1:196642987-196643092	106	CFAH_HUMAN	82-117	36	0	-	-
1.4	ENST00000367429	4	ENSE00000791014	chr1:196645119-196645195	77	CFAH_HUMAN	117-143	27	0	-	-
1.5b	ENST00000367429	5b	ENSE00000469039	chr1:196646606-196646797	192	CFAH_HUMAN	143-207	65	0	-	-
1.5c	ENST00000367429	5c	ENSE00000791016	chr1:196648753-196648923	171	CFAH_HUMAN	207-264	58	0	-	-
1.6	ENST00000367429	6	ENSE00000469041	chr1:196654194-196654367	174	CFAH_HUMAN	264-322	59	0	-	-
1.7	ENST00000367429	7	ENSE00001769047	chr1:196658550-196658744	195	CFAH_HUMAN	322-387	66	0	-	-
1.8a	ENST00000367429	8a	ENSE00001597868	chr1:196659193-196659369	177	CFAH_HUMAN	387-446	60	0	-	-
1.12	ENST00000367429	12	ENSE00000469044	chr1:196682865-196683047	183	CFAH_HUMAN	446-507	62	0	-	-
1.13	ENST00000367429	13	ENSE00000469045	chr1:196684723-196684899	177	CFAH_HUMAN	507-566	60	0	-	-
1.14	ENST00000367429	14	ENSE00000791022	chr1:196694251-196694427	177	CFAH_HUMAN	566-625	60	0	-	-
1.15	ENST00000367429	15	ENSE00000791023	chr1:196695600-196695782	183	CFAH_HUMAN	625-686	62	0	-	-
1.16	ENST00000367429	16	ENSE00000469048	chr1:196695891-196696070	180	CFAH_HUMAN	686-746	61	0	-	-
1.17	ENST00000367429	17	ENSE00000791025	chr1:196697476-196697652	177	CFAH_HUMAN	746-805	60	0	-	-
1.18a	ENST00000367429	18a	ENSE00000791026	chr1:196705954-196706136	183	CFAH_HUMAN	805-866	62	0	-	-
1.19	ENST00000367429	19	ENSE00000791027	chr1:196706605-196706790	186	CFAH_HUMAN	866-928	63	0	-	-
1.20a	ENST00000367429	20a	ENSE00000791028	chr1:196709749-196709922	174	CFAH_HUMAN	928-986	59	0	-	-
1.20d	ENST00000367429	20d	ENSE00000469053	chr1:196711005-196711181	177	CFAH_HUMAN	986-1045	60	1	X:1045-1045	1
1.21	ENST00000367429	21	ENSE00001622338	chr1:196712582-196712758	177	CFAH_HUMAN	1045-1104	60	1	X:1045-1104	60
1.22	ENST00000367429	22	ENSE00001719380	chr1:196714947-196715129	183	CFAH_HUMAN	1104-1165	62	1	X:1104-1165	62
1.23	ENST00000367429	23	ENSE00001931000	chr1:196716241-196716634	394	CFAH_HUMAN	1165-1231	67	1	X:1165-1230	66

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain X from PDB  Type:PROTEIN  Length:186
 aligned with CFAH_HUMAN | P08603 from UniProtKB/Swiss-Prot  Length:1231

    Alignment length:186
                                  1054      1064      1074      1084      1094      1104      1114      1124      1134      1144      1154      1164      1174      1184      1194      1204      1214      1224      
          CFAH_HUMAN   1045 DTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAK 1230
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ............eee............eeeeee....eee...eeeee..ee....eee..............eee............eeeeee....eee...eeeee..ee....eee..ee.hhhhhhhhheee........ee....eeeeee....ee.......eee..........ee. Sec.struct. author
             SAPs(SNPs) (1) -----Y--------T----------------E-S----------------------------------------G--------------G-------DE-------------R-----W-----L-------------CR----R-L--D--AAS----------C----G----------S---- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------------------------------------------L-------------------------------Q--------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ------------------------------------------------------------------------------------------------------------------------------------------R----------------------------------------------- SAPs(SNPs) (3)
                    PROSITE SSUSHI  PDB: X:1046-1104 UniProt: 1046-1104                 --SUSHI  PDB: X:1107-1165 UniProt: 1107-1165                 ----------------------------SUSHI  PDB: X:1194-1230               PROSITE
           Transcript 1 (1) 1----------------------------------------------------------Exon 1.22  PDB: X:1104-1165 UniProt: 1104-1165                ----------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) Exon 1.21  PDB: X:1045-1104 UniProt: 1045-1104              ------------------------------------------------------------Exon 1.23  PDB: X:1165-1230 UniProt: 1165-1231 [INCOMPLETE]        Transcript 1 (2)
                3sw0 X 1045 GTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAK 1230
                                  1054      1064      1074      1084      1094      1104      1114      1124      1134      1144      1154      1164      1174      1184      1194      1204      1214      1224

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

(no "SCOP Domain" information available for 3SW0)

CATH Domains (0, 0)

(no "CATH Domain" information available for 3SW0)

Pfam Domains (0, 0)

(no "Pfam Domain" information available for 3SW0)

Gene Ontology (12, 12)

Asymmetric/Biological Unit(hide GO term definitions)

Chain X (CFAH_HUMAN | P08603)

molecular function
	GO:0043395	heparan sulfate proteoglycan binding	Interacting selectively and non-covalently with a heparan sulfate proteoglycan, any proteoglycan containing heparan sulfate as the glycosaminoglycan carbohydrate unit.
	GO:0008201	heparin binding	Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006956	complement activation	Any process involved in the activation of any of the steps of the complement cascade, which allows for the direct killing of microbes, the disposal of immune complexes, and the regulation of other immune processes; the initial steps of complement activation involve one of three pathways, the classical pathway, the alternative pathway, and the lectin pathway, all of which lead to the terminal complement pathway.
	GO:0006957	complement activation, alternative pathway	Any process involved in the activation of any of the steps of the alternative pathway of the complement cascade which allows for the direct killing of microbes and the regulation of other immune processes.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0030449	regulation of complement activation	Any process that modulates the frequency, rate or extent of complement activation.
cellular component
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ser X:1079 - Pro X:1080	[ RasMol ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	3sw0
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CFAH_HUMAN \| P08603
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	235400
		Disease Information	:	OMIM
	609814
		Disease Information	:	OMIM
	610698
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CFAH_HUMAN \| P08603
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
	CFAH_HUMAN \| P08603	:	1fhc 1haq 1hcc 1hfh 1hfi 1kov 2bzm 2g7i 2ic4 2jgw 2jgx 2kms 2qfg 2qfh 2rlp 2rlq 2uwn 2v8e 2w80 2w81 2wii 2xqw 3gau 3gav 3gaw 3kxv 3kzj 3oxu 3r62 3rj3 4ayd 4aye 4ayi 4aym 4b2r 4b2s 4j38 4k12 4ont 4zh1 5o32 5o35

Related Entries Specified in the PDB File

3oxu	FH19-20 IN COMPLEX WITH C3D