![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 2) Biological Unit 1 (1, 1) Biological Unit 2 (1, 1) |
Asymmetric Unit (1, 1)
|
(no "SS Bond" information available for 3C03) |
(no "Cis Peptide Bond" information available for 3C03) |
(no "SAP(SNP)/Variant" information available for 3C03) |
(no "PROSITE Motif" information available for 3C03) |
(no "Exon" information available for 3C03) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:98 aligned with Q9AJ26_ECOLX | Q9AJ26 from UniProtKB/TrEMBL Length:345 Alignment length:99 256 266 276 286 296 306 316 326 336 Q9AJ26_ECOLX 247 GSLANNIKKSTVIVKNPTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAIDLDY 345 SCOP domains d3c03a_ A: Type III secretion proteins EscU SCOP domains CATH domains 3c03A00 A:247-343 secretion proteins EscU -- CATH domains Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 3c03 A 247 GSLANNIKKSTVIVKNATHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAIDL-P 4 256 266 276 286 296 306 316 326 336 | | 343 4 Chain B from PDB Type:PROTEIN Length:18 aligned with Q9AJ26_ECOLX | Q9AJ26 from UniProtKB/TrEMBL Length:345 Alignment length:18 254 Q9AJ26_ECOLX 245 QSGSLANNIKKSTVIVKN 262 SCOP domains ------------------ SCOP domains CATH domains ------------------ CATH domains Pfam domains ------------------ Pfam domains SAPs(SNPs) ------------------ SAPs(SNPs) PROSITE ------------------ PROSITE Transcript ------------------ Transcript 3c03 B 245 QSGSLANNIKKSTVIVKd 262 254 | 262-SNN Chain C from PDB Type:PROTEIN Length:80 aligned with Q9AJ26_ECOLX | Q9AJ26 from UniProtKB/TrEMBL Length:345 Alignment length:80 273 283 293 303 313 323 333 343 Q9AJ26_ECOLX 264 THIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAIDL 343 SCOP domains -------------------------------------------------------------------------------- SCOP domains CATH domains 3c03C00 C:264-343 secretion proteins EscU CATH domains Pfam domains -------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------- Transcript 3c03 C 264 THIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAIDL 343 273 283 293 303 313 323 333 343
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 3C03) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C (Q9AJ26_ECOLX | Q9AJ26)
|
|
|
|
|
|
|