|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3BZS) |
Sites (0, 0)| (no "Site" information available for 3BZS) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3BZS) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3BZS) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3BZS) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3BZS) |
Exons (0, 0)| (no "Exon" information available for 3BZS) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:94 aligned with Q9AJ26_ECOLX | Q9AJ26 from UniProtKB/TrEMBL Length:345 Alignment length:94 257 267 277 287 297 307 317 327 337 Q9AJ26_ECOLX 248 SLANNIKKSTVIVKNPTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAI 341 SCOP domains d3bzsa_ A: Type III secretion proteins EscU SCOP domains CATH domains 3bzsA00 A:248-341 secretion proteins EscU CATH domains Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------- Transcript 3bzs A 248 SLANNIKKSTVIVKDPTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAI 341 257 267 277 287 297 307 317 327 337
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3BZS) |
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q9AJ26_ECOLX | Q9AJ26)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|