![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 3C00) |
(no "Site" information available for 3C00) |
(no "SS Bond" information available for 3C00) |
(no "Cis Peptide Bond" information available for 3C00) |
(no "SAP(SNP)/Variant" information available for 3C00) |
(no "PROSITE Motif" information available for 3C00) |
(no "Exon" information available for 3C00) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:19 aligned with Q9AJ26_ECOLX | Q9AJ26 from UniProtKB/TrEMBL Length:345 Alignment length:19 253 Q9AJ26_ECOLX 244 IQSGSLANNIKKSTVIVKN 262 SCOP domains ------------------- SCOP domains CATH domains ------------------- CATH domains Pfam domains ------------------- Pfam domains SAPs(SNPs) ------------------- SAPs(SNPs) PROSITE ------------------- PROSITE Transcript ------------------- Transcript 3c00 A 244 IQSTSLANNIKKSTVIVKN 262 253 Chain B from PDB Type:PROTEIN Length:83 aligned with Q9AJ26_ECOLX | Q9AJ26 from UniProtKB/TrEMBL Length:345 Alignment length:83 272 282 292 302 312 322 332 342 Q9AJ26_ECOLX 263 PTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAIDLDY 345 SCOP domains ----------------------------------------------------------------------------------- SCOP domains CATH domains 3c00B00 B:263-345 secretion proteins EscU CATH domains Pfam domains ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------- Transcript 3c00 B 263 PTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAIDLDY 345 272 282 292 302 312 322 332 342
|
(no "SCOP Domain" information available for 3C00) |
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 3C00) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q9AJ26_ECOLX | Q9AJ26)
|
|
|
|
|
|
|