![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 1)
|
Asymmetric Unit (1, 1)
|
(no "SS Bond" information available for 3BZY) |
(no "Cis Peptide Bond" information available for 3BZY) |
(no "SAP(SNP)/Variant" information available for 3BZY) |
(no "PROSITE Motif" information available for 3BZY) |
(no "Exon" information available for 3BZY) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:17 aligned with Q9AJ26_ECOLX | Q9AJ26 from UniProtKB/TrEMBL Length:345 Alignment length:17 255 Q9AJ26_ECOLX 246 SGSLANNIKKSTVIVKN 262 SCOP domains d3bzy.1 SCOP domains CATH domains ----------------- CATH domains Pfam domains ----------------- Pfam domains SAPs(SNPs) ----------------- SAPs(SNPs) PROSITE ----------------- PROSITE Transcript ----------------- Transcript 3bzy A 246 SGSLANNIKKSTVIVKN 262 255 Chain B from PDB Type:PROTEIN Length:83 aligned with Q9AJ26_ECOLX | Q9AJ26 from UniProtKB/TrEMBL Length:345 Alignment length:83 272 282 292 302 312 322 332 342 Q9AJ26_ECOLX 263 PTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAIDLDY 345 SCOP domains d3bzy.1 A:246-262,B:263-345 Type III secretion proteins EscU SCOP domains CATH domains 3bzyB00 B:263-345 secretion proteins EscU CATH domains Pfam domains ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------- Transcript 3bzy B 263 PTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLDKNIHKGQYITEDFFEPVAQLIRIAIDLDY 345 272 282 292 302 312 322 332 342
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 3BZY) |
Asymmetric Unit(hide GO term definitions) Chain A,B (Q9AJ26_ECOLX | Q9AJ26)
|
|
|
|
|
|
|