|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 11)| Asymmetric/Biological Unit (3, 11) |
Sites (11, 11)
Asymmetric Unit (11, 11)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3SD6) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3SD6) |
SAPs(SNPs)/Variants (3, 3)
Asymmetric/Biological Unit (3, 3)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (2, 3)
Asymmetric/Biological Unit (2, 3)
|
||||||||||||||||||||||||||||||||
Exons (4, 4)
Asymmetric/Biological Unit (4, 4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:86 aligned with TNNC1_HUMAN | P63316 from UniProtKB/Swiss-Prot Length:161 Alignment length:89 10 20 30 40 50 60 70 80 TNNC1_HUMAN 1 MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS 89 SCOP domains d3sd6a_ A: Troponin C SCOP domains CATH domains ----------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------V--------------------Q------------------------------------------------------Y----- SAPs(SNPs) PROSITE (1) --------------------------------EF_HAND_2 EF_HAND_2 PDB: A:52-87 -- PROSITE (1) PROSITE (2) ----------------------------------------------------------------EF_HAND_1 ------------ PROSITE (2) Transcript 1 (1) Exon 1.1Exon 1.2b ------------------------------------------------Exon 1.4b PDB: A:70-8 Transcript 1 (1) Transcript 1 (2) ------------------Exon 1.3 PDB: A:19-66 UniProt: 19-68 [INCOMPLETE]--------------------- Transcript 1 (2) 3sd6 A 1 MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDE---GTVDFDEFLVMMVRCMKDDS 89 10 20 30 40 50 60 | 70 80 66 70
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3SD6) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3SD6) |
Gene Ontology (23, 23)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (TNNC1_HUMAN | P63316)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|