1LXF - JenaLib

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - model 1, sites (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   STRUCTURE OF THE REGULATORY N-DOMAIN OF HUMAN CARDIAC TROPONIN C IN COMPLEX WITH HUMAN CARDIAC TROPONIN-I(147-163) AND BEPRIDIL

Authors :   X. Wang, M. X. Li, B. D. Sykes

Date :   05 Jun 02 (Deposition) - 11 Dec 02 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : C,I  (30x)

Keywords :   Muscle, Cardiac Troponin C-Drug Interaction, Bepridil, Cardiac Troponin I-Drug Interaction, Metal Binding Protein, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   X. Wang, M. X. Li, B. D. Sykes
Structure Of The Regulatory N-Domain Of Human Cardiac Troponin C In Complex With Human Cardiac Troponin I147-163 And Bepridil.
J. Biol. Chem. V. 277 31124 2002
PubMed-ID: 12060657 | Reference-DOI: 10.1074/JBC.M203896200
(for further references see the PDB file header)

Molecule 1 - TROPONIN C, SLOW SKELETAL AND CARDIAC MUSCLES
	Chains	:	C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET-3A
	Expression System Strain	:	BL21-(DE3PLYSS)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	REGULATORY N DOMAIN (RESIDUES 1-89)
	Gene	:	TNNC
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CARDIAC TROPONIN C, TN-C

Molecule 2 - TROPONIN I, CARDIAC MUSCLE
	Chains	:	I
	Engineered	:	YES
	Fragment	:	SWITCH PEPTIDE (RESIDUES 147-163)
	Other Details	:	THE SEQUENCE OF THE PROTEIN IS NATURALLY FOUND IN HOMO SAPIENS. THE PROTEIN WAS CHEMICALLY SYNTHESIZED.
	Synthetic	:	YES


NMR Structure (30x)	:

Summary Information (see also Sequences/Alignments below)

NMR Structure (2, 2)

No.	Name	Count	Type	Full Name
1	BEP	1	Ligand/Ion	1-ISOBUTOXY-2-PYRROLIDINO-3[N-BENZYLANILINO] PROPANE
2	CA	1	Ligand/Ion	CALCIUM ION

NMR Structure (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	VAL C:64 , ASP C:65 , ASP C:67 , SER C:69 , THR C:71 , GLU C:76	BINDING SITE FOR RESIDUE CA C 93
2	AC2	SOFTWARE	PHE C:27 , LEU C:41 , MET C:45 , LEU C:48 , MET C:60 , ILE C:61 , VAL C:72 , PHE C:77 , MET C:80 , MET C:81 , CYS C:84 , ILE I:148 , MET I:153	BINDING SITE FOR RESIDUE BEP C 92

(no "SS Bond" information available for 1LXF)

(no "Cis Peptide Bond" information available for 1LXF)

NMR Structure (6, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_063070	A	8	V	TNNC1_HUMAN	Disease (CMH13)	267607125	C	A	8	V
2	UniProt	VAR_019776	L	29	Q	TNNC1_HUMAN	Disease (CMH13)	267607123	C	L	29	Q
3	UniProt	VAR_063071	C	84	Y	TNNC1_HUMAN	Disease (CMH13)	267607126	C	C	84	Y
4	UniProt	VAR_019873	A	157	V	TNNI3_HUMAN	Disease (CMH7)	397516353	I	A	156	V
5	UniProt	VAR_019874	R	162	P	TNNI3_HUMAN	Disease (CMH7)	397516354	I	R	161	P
6	UniProt	VAR_042745	R	162	Q	TNNI3_HUMAN	Disease (CMH7)	397516354	I	R	161	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure (2, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	TNNC1_HUMAN	33-51 52-87 92-127 128-161	2	C:33-51 C:52-87 - -
2	EF_HAND_1	PS00018	EF-hand calcium-binding domain.	TNNC1_HUMAN	65-77 105-117 141-153	1	C:65-77 - -

NMR Structure (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000232975	1	ENSE00001063786	chr3:52488086-52488008	79	TNNC1_HUMAN	1-8	8	1	C:1-8	8
1.2b	ENST00000232975	2b	ENSE00000770833	chr3:52486529-52486499	31	TNNC1_HUMAN	9-19	11	1	C:9-19	11
1.3	ENST00000232975	3	ENSE00000770832	chr3:52486268-52486122	147	TNNC1_HUMAN	19-68	50	1	C:19-68	50
1.4b	ENST00000232975	4b	ENSE00000770831	chr3:52485874-52485760	115	TNNC1_HUMAN	68-106	39	1	C:68-89	22
1.5c	ENST00000232975	5c	ENSE00000770830	chr3:52485543-52485407	137	TNNC1_HUMAN	106-152	47	0	-	-
1.6	ENST00000232975	6	ENSE00001063787	chr3:52485322-52485118	205	TNNC1_HUMAN	152-161	10	0	-	-

2.1	ENST00000344887	1	ENSE00001524342	chr19:55669100-55668947	154	TNNI3_HUMAN	1-4	4	0	-	-
2.2	ENST00000344887	2	ENSE00001758167	chr19:55668676-55668664	13	TNNI3_HUMAN	4-8	5	0	-	-
2.3	ENST00000344887	3	ENSE00001250420	chr19:55668501-55668418	84	TNNI3_HUMAN	9-36	28	0	-	-
2.4	ENST00000344887	4	ENSE00000727912	chr19:55668012-55667971	42	TNNI3_HUMAN	37-50	14	0	-	-
2.5	ENST00000344887	5	ENSE00000727909	chr19:55667700-55667569	132	TNNI3_HUMAN	51-94	44	0	-	-
2.6	ENST00000344887	6	ENSE00000417663	chr19:55666198-55666109	90	TNNI3_HUMAN	95-124	30	0	-	-
2.7	ENST00000344887	7	ENSE00000856455	chr19:55665574-55665398	177	TNNI3_HUMAN	125-183	59	1	I:147-163	17
2.8	ENST00000344887	8	ENSE00001250409	chr19:55663285-55663138	148	TNNI3_HUMAN	184-210	27	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain C from PDB  Type:PROTEIN  Length:89
 aligned with TNNC1_HUMAN | P63316 from UniProtKB/Swiss-Prot  Length:161

    Alignment length:89
                                    10        20        30        40        50        60        70        80         
          TNNC1_HUMAN     1 MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS  89
               SCOP domains d1lxfc_ C: Troponin C                                                                     SCOP domains
               CATH domains 1lxfC00 C:1-89 EF-hand                                                                    CATH domains
               Pfam domains -------------------------------EF_hand_6-1lxfC01 C:32-84                            ----- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhh....hhhhhhhhhhhhh.......hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------V--------------------Q------------------------------------------------------Y----- SAPs(SNPs)
                PROSITE (1) --------------------------------EF_HAND_2          EF_HAND_2  PDB: C:52-87             -- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------EF_HAND_1    ------------ PROSITE (2)
           Transcript 1 (1) Exon 1.1Exon 1.2b  ------------------------------------------------Exon 1.4b  PDB: C:68-8 Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.3  PDB: C:19-68 UniProt: 19-68             --------------------- Transcript 1 (2)
                 1lxf C   1 MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS  89
                                    10        20        30        40        50        60        70        80

Chain I from PDB  Type:PROTEIN  Length:17
 aligned with TNNI3_HUMAN | P19429 from UniProtKB/Swiss-Prot  Length:210

    Alignment length:17
                                   157       
          TNNI3_HUMAN   148 RISADAMMQALLGARAK 164
               SCOP domains d1lxfi_ I:        SCOP domains
               CATH domains ----------------- CATH domains
               Pfam domains Troponin-1lxfI01  Pfam domains
         Sec.struct. author ...hhhhhhhh...... Sec.struct. author
             SAPs(SNPs) (1) ---------V----P-- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------Q-- SAPs(SNPs) (2)
                    PROSITE ----------------- PROSITE
               Transcript 2 Exon 2.7          Transcript 2
                 1lxf I 147 RISADAMMQALLGARAK 163
                                   156

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: EF Hand-like (739)

Superfamily: EF-hand (657)

Family: Calmodulin-like (356)

Protein domain: Troponin C (53)

Human (Homo sapiens), cardiac isoform [TaxId: 9606] (16)

d1lxfc_

Class: Peptides (792)

Fold: Troponin I fragments (5)

Superfamily: Troponin I fragments (5)

Family: Troponin I fragments (5)

Protein domain: Troponin I fragments (5)

Human (Homo sapiens), cardiac isoform [TaxId: 9606] (2)

d1lxfi_

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Recoverin; domain 1 (474)

Homologous Superfamily: EF-hand (412)

Human (Homo sapiens) (106)

1lxfC00

C:1-89

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: EF_hand (270)

Family: EF_hand_6 (75)

Homo sapiens (Human) (34)

EF_hand_6-1lxfC01

C:32-84

Clan: no clan defined [family: Troponin] (10)

Family: Troponin (10)

Homo sapiens (Human) (5)

Troponin-1lxfI01

I:147-163

NMR Structure(hide GO term definitions)

Chain C (TNNC1_HUMAN | P63316)

molecular function
	GO:0051015	actin filament binding	Interacting selectively and non-covalently with an actin filament, also known as F-actin, a helical filamentous polymer of globular G-actin subunits.
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0048306	calcium-dependent protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules), in the presence of calcium.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0031013	troponin I binding	Interacting selectively and non-covalently with troponin I, the inhibitory subunit of the troponin complex.
	GO:0031014	troponin T binding	Interacting selectively and non-covalently with troponin T, the tropomyosin-binding subunit of the troponin complex.
biological process
	GO:0060048	cardiac muscle contraction	Muscle contraction of cardiac muscle tissue.
	GO:0002086	diaphragm contraction	A process in which force is generated within involuntary skeletal muscle tissue, resulting in a change in muscle geometry. This process occurs in the diaphragm. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. The diaphragm is a striated muscle that is necessary for the process of respiratory gaseous exchange.
	GO:0030049	muscle filament sliding	The sliding of actin thin filaments and myosin thick filaments past each other in muscle contraction. This involves a process of interaction of myosin located on a thick filament with actin located on a thin filament. During this process ATP is split and forces are generated.
	GO:0043462	regulation of ATPase activity	Any process that modulates the rate of ATP hydrolysis by an ATPase.
	GO:0006937	regulation of muscle contraction	Any process that modulates the frequency, rate or extent of muscle contraction.
	GO:0032972	regulation of muscle filament sliding speed	Any process that modulates the velocity of muscle filament sliding.
	GO:0010038	response to metal ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a metal ion stimulus.
	GO:0014883	transition between fast and slow fiber	The process of conversion of fast-contracting muscle fibers to a slower character. This may involve slowing of contractile rate, slow myosin gene induction, increase in oxidative metabolic properties, altered electrophysiology and altered innervation. This process also regulates skeletal muscle adapatation.
	GO:0055010	ventricular cardiac muscle tissue morphogenesis	The process in which the anatomical structures of cardiac ventricle muscle is generated and organized.
cellular component
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0043292	contractile fiber	Fibers, composed of actin, myosin, and associated proteins, found in cells of smooth or striated muscle.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005861	troponin complex	A complex of accessory proteins (typically troponin T, troponin I and troponin C) found associated with actin in muscle thin filaments; involved in calcium regulation of muscle contraction.

Chain I (TNNI3_HUMAN | P19429)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0019855	calcium channel inhibitor activity	Stops, prevents, or reduces the activity of a calcium channel.
	GO:0048306	calcium-dependent protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules), in the presence of calcium.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
	GO:0030172	troponin C binding	Interacting selectively and non-covalently with troponin C, the calcium-binding subunit of the troponin complex.
	GO:0031014	troponin T binding	Interacting selectively and non-covalently with troponin T, the tropomyosin-binding subunit of the troponin complex.
biological process
	GO:0060048	cardiac muscle contraction	Muscle contraction of cardiac muscle tissue.
	GO:0006874	cellular calcium ion homeostasis	Any process involved in the maintenance of an internal steady state of calcium ions at the level of a cell.
	GO:0060047	heart contraction	The multicellular organismal process in which the heart decreases in volume in a characteristic way to propel blood through the body.
	GO:0007507	heart development	The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0030049	muscle filament sliding	The sliding of actin thin filaments and myosin thick filaments past each other in muscle contraction. This involves a process of interaction of myosin located on a thick filament with actin located on a thin filament. During this process ATP is split and forces are generated.
	GO:0032780	negative regulation of ATPase activity	Any process that stops or reduces the rate of ATP hydrolysis by an ATPase.
	GO:1903779	regulation of cardiac conduction	Any process that modulates the frequency, rate or extent of cardiac conduction.
	GO:0006937	regulation of muscle contraction	Any process that modulates the frequency, rate or extent of muscle contraction.
	GO:0006940	regulation of smooth muscle contraction	Any process that modulates the frequency, rate or extent of smooth muscle contraction.
	GO:0001980	regulation of systemic arterial blood pressure by ischemic conditions	The process that modulates blood pressure by the detection of carbon dioxide levels in the brain stem. Increased levels activate the sympathetic vasoconstrictor mechanism increasing the force with which blood flows through the circulatory system.
	GO:0003009	skeletal muscle contraction	A process in which force is generated within skeletal muscle tissue, resulting in a change in muscle geometry. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. In the skeletal muscle, the muscle contraction takes advantage of an ordered sarcomeric structure and in most cases it is under voluntary control.
	GO:0006941	striated muscle contraction	A process in which force is generated within striated muscle tissue, resulting in the shortening of the muscle. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. Striated muscle is a type of muscle in which the repeating units (sarcomeres) of the contractile myofibrils are arranged in registry throughout the cell, resulting in transverse or oblique striations observable at the level of the light microscope.
	GO:0001570	vasculogenesis	The differentiation of endothelial cells from progenitor cells during blood vessel development, and the de novo formation of blood vessels and tubes.
	GO:0055010	ventricular cardiac muscle tissue morphogenesis	The process in which the anatomical structures of cardiac ventricle muscle is generated and organized.
cellular component
	GO:0043292	contractile fiber	Fibers, composed of actin, myosin, and associated proteins, found in cells of smooth or striated muscle.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0030016	myofibril	The contractile element of skeletal and cardiac muscle; a long, highly organized bundle of actin, myosin, and other proteins that contracts by a sliding filament mechanism.
	GO:0030017	sarcomere	The repeating unit of a myofibril in a muscle cell, composed of an array of overlapping thick and thin filaments between two adjacent Z discs.
	GO:0005861	troponin complex	A complex of accessory proteins (typically troponin T, troponin I and troponin C) found associated with actin in muscle thin filaments; involved in calcium regulation of muscle contraction.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		BEP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1lxf)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - model 1, sites PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1lxf
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TNNC1_HUMAN \| P63316
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TNNI3_HUMAN \| P19429
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	613243
		Disease Information	:	OMIM
	613690
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	TNNC1_HUMAN \| P63316
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TNNI3_HUMAN \| P19429
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1LXF)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (6, 6)

PROSITE Motifs (2, 3)

Exons (5, 5)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (1, 1)

Pfam Domains (2, 2)

Gene Ontology (41, 52)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File