1J1D - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE 46KDA DOMAIN OF HUMAN CARDIAC TROPONIN IN THE CA2+ SATURATED FORM

Authors :   S. Takeda, A. Yamashita, K. Maeda, Y. Maeda

Date :   03 Dec 02 (Deposition) - 15 Jul 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.61

Chains :   Asym. Unit : A,B,C,D,E,F
Biol. Unit 1: A,B,C  (1x)
Biol. Unit 2: D,E,F  (1x)

Keywords :   Thin Filament, Muscle Regulation, Ca2+ Binding Protein, Ef- Hand, Coiled-Coil, Contractile Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Takeda, A. Yamashita, K. Maeda, Y. Maeda
Structure Of The Core Domain Of Human Cardiac Troponin In The Ca2+-Saturated Form
Nature V. 424 35 2003
PubMed-ID: 12840750 | Reference-DOI: 10.1038/NATURE01780
(for further references see the PDB file header)

Molecule 1 - TROPONIN C
	Chains	:	A, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET3D
	Expression System Strain	:	BL21(DE3)PLYSS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TNC
	Tissue	:	CARDIAC MUSCLE

Molecule 2 - TROPONIN T
	Chains	:	B, E
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET3D
	Expression System Strain	:	BL21(DE3)PLYSS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	CNBR FRAGMENT, RESIDUES 183-288
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TNT
	Tissue	:	CARDIAC MUSCLE

Molecule 3 - TROPONIN I
	Chains	:	C, F
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET3D
	Expression System Strain	:	BL21(DE3)PLYSS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 31-163
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TNI
	Tissue	:	CARDIAC MUSCLE

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	C	D	E	F
Biological Unit 1 (1x)	:	A	B	C
Biological Unit 2 (1x)	:				D	E	F

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 6)

No.	Name	Count	Type	Full Name
1	CA	6	Ligand/Ion	CALCIUM ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:65 , ASP A:67 , SER A:69 , THR A:71 , ASP A:73 , GLU A:76	BINDING SITE FOR RESIDUE CA A 201
2	AC2	SOFTWARE	ASP A:105 , ASN A:107 , ASP A:109 , TYR A:111 , GLU A:116	BINDING SITE FOR RESIDUE CA A 202
3	AC3	SOFTWARE	ASP A:141 , ASN A:143 , ASP A:145 , ARG A:147 , ILE A:148 , GLU A:152	BINDING SITE FOR RESIDUE CA A 203
4	AC4	SOFTWARE	ASP D:65 , ASP D:67 , SER D:69 , THR D:71 , GLU D:76	BINDING SITE FOR RESIDUE CA D 201
5	AC5	SOFTWARE	ASP D:105 , ASN D:107 , ASP D:109 , TYR D:111 , ASP D:113 , GLU D:116	BINDING SITE FOR RESIDUE CA D 202
6	AC6	SOFTWARE	ASP D:141 , ASN D:143 , ASP D:145 , ARG D:147 , GLU D:152	BINDING SITE FOR RESIDUE CA D 203

(no "SS Bond" information available for 1J1D)

(no "Cis Peptide Bond" information available for 1J1D)

Asymmetric Unit (23, 41)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_063070	A	8	V	TNNC1_HUMAN	Disease (CMH13)	267607125	A/D	A	8	V
02	UniProt	VAR_019776	L	29	Q	TNNC1_HUMAN	Disease (CMH13)	267607123	A/D	L	29	Q
03	UniProt	VAR_063548	K	36	Q	TNNI3_HUMAN	Disease (CMD1FF)	267607130	C	K	36	Q
04	UniProt	VAR_029453	R	79	C	TNNI3_HUMAN	Polymorphism	3729712	C/F	R	79	C
05	UniProt	VAR_016078	P	82	S	TNNI3_HUMAN	Disease (CMH7)	77615401	C/F	P	82	S
06	UniProt	VAR_063071	C	84	Y	TNNC1_HUMAN	Disease (CMH13)	267607126	A/D	S	84	Y
07	UniProt	VAR_067264	A	116	G	TNNI3_HUMAN	Disease (CMD1FF)	777177571	C/F	A	116	G
08	UniProt	VAR_063072	E	134	D	TNNC1_HUMAN	Disease (CMH13)	397516847	A/D	E	134	D
09	UniProt	VAR_063073	D	145	E	TNNC1_HUMAN	Disease (CMH13)	267607124	A/D	D	145	E
10	UniProt	VAR_007603	R	145	G	TNNI3_HUMAN	Disease (CMH7)	104894724	C	R	145	G
11	UniProt	VAR_016080	R	145	W	TNNI3_HUMAN	Disease (RCM1)	28934871	C	R	145	W
12	UniProt	VAR_019873	A	157	V	TNNI3_HUMAN	Disease (CMH7)	397516353	C/F	A	157	V
13	UniProt	VAR_043988	G	159	R	TNNC1_HUMAN	Disease (CMD1Z)	---	A/D	G	159	R
14	UniProt	VAR_019874	R	162	P	TNNI3_HUMAN	Disease (CMH7)	397516354	F	R	162	P
15	UniProt	VAR_042745	R	162	Q	TNNI3_HUMAN	Disease (CMH7)	397516354	F	R	162	Q
16	UniProt	VAR_043984	R	215	L	TNNT2_HUMAN	Disease (CMD1D)	121964860	B/E	R	205	L
17	UniProt	VAR_042748	I	221	T	TNNT2_HUMAN	Polymorphism	45520032	B/E	I	211	T
18	UniProt	VAR_057310	I	231	T	TNNT2_HUMAN	Polymorphism	45520032	B/E	I	221	T
19	UniProt	VAR_013022	S	249	T	TNNT2_HUMAN	Polymorphism	2996495	B/E	T	239	T
20	UniProt	VAR_007610	E	254	D	TNNT2_HUMAN	Disease (CMH2)	45466197	B/E	E	244	D
21	UniProt	VAR_007611	K	263	R	TNNT2_HUMAN	Polymorphism	3730238	B/E	K	253	R
22	UniProt	VAR_029451	N	279	Y	TNNT2_HUMAN	Polymorphism	4523540	B/E	N	269	Y
23	UniProt	VAR_019879	N	281	I	TNNT2_HUMAN	Disease (CMH2)	863225119	B/E	N	271	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (21, 21)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_063070	A	8	V	TNNC1_HUMAN	Disease (CMH13)	267607125	A	A	8	V
02	UniProt	VAR_019776	L	29	Q	TNNC1_HUMAN	Disease (CMH13)	267607123	A	L	29	Q
03	UniProt	VAR_063548	K	36	Q	TNNI3_HUMAN	Disease (CMD1FF)	267607130	C	K	36	Q
04	UniProt	VAR_029453	R	79	C	TNNI3_HUMAN	Polymorphism	3729712	C	R	79	C
05	UniProt	VAR_016078	P	82	S	TNNI3_HUMAN	Disease (CMH7)	77615401	C	P	82	S
06	UniProt	VAR_063071	C	84	Y	TNNC1_HUMAN	Disease (CMH13)	267607126	A	S	84	Y
07	UniProt	VAR_067264	A	116	G	TNNI3_HUMAN	Disease (CMD1FF)	777177571	C	A	116	G
08	UniProt	VAR_063072	E	134	D	TNNC1_HUMAN	Disease (CMH13)	397516847	A	E	134	D
09	UniProt	VAR_063073	D	145	E	TNNC1_HUMAN	Disease (CMH13)	267607124	A	D	145	E
10	UniProt	VAR_007603	R	145	G	TNNI3_HUMAN	Disease (CMH7)	104894724	C	R	145	G
11	UniProt	VAR_016080	R	145	W	TNNI3_HUMAN	Disease (RCM1)	28934871	C	R	145	W
12	UniProt	VAR_019873	A	157	V	TNNI3_HUMAN	Disease (CMH7)	397516353	C	A	157	V
13	UniProt	VAR_043988	G	159	R	TNNC1_HUMAN	Disease (CMD1Z)	---	A	G	159	R
16	UniProt	VAR_043984	R	215	L	TNNT2_HUMAN	Disease (CMD1D)	121964860	B	R	205	L
17	UniProt	VAR_042748	I	221	T	TNNT2_HUMAN	Polymorphism	45520032	B	I	211	T
18	UniProt	VAR_057310	I	231	T	TNNT2_HUMAN	Polymorphism	45520032	B	I	221	T
19	UniProt	VAR_013022	S	249	T	TNNT2_HUMAN	Polymorphism	2996495	B	T	239	T
20	UniProt	VAR_007610	E	254	D	TNNT2_HUMAN	Disease (CMH2)	45466197	B	E	244	D
21	UniProt	VAR_007611	K	263	R	TNNT2_HUMAN	Polymorphism	3730238	B	K	253	R
22	UniProt	VAR_029451	N	279	Y	TNNT2_HUMAN	Polymorphism	4523540	B	N	269	Y
23	UniProt	VAR_019879	N	281	I	TNNT2_HUMAN	Disease (CMH2)	863225119	B	N	271	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (20, 20)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_063070	A	8	V	TNNC1_HUMAN	Disease (CMH13)	267607125	D	A	8	V
02	UniProt	VAR_019776	L	29	Q	TNNC1_HUMAN	Disease (CMH13)	267607123	D	L	29	Q
04	UniProt	VAR_029453	R	79	C	TNNI3_HUMAN	Polymorphism	3729712	F	R	79	C
05	UniProt	VAR_016078	P	82	S	TNNI3_HUMAN	Disease (CMH7)	77615401	F	P	82	S
06	UniProt	VAR_063071	C	84	Y	TNNC1_HUMAN	Disease (CMH13)	267607126	D	S	84	Y
07	UniProt	VAR_067264	A	116	G	TNNI3_HUMAN	Disease (CMD1FF)	777177571	F	A	116	G
08	UniProt	VAR_063072	E	134	D	TNNC1_HUMAN	Disease (CMH13)	397516847	D	E	134	D
09	UniProt	VAR_063073	D	145	E	TNNC1_HUMAN	Disease (CMH13)	267607124	D	D	145	E
12	UniProt	VAR_019873	A	157	V	TNNI3_HUMAN	Disease (CMH7)	397516353	F	A	157	V
13	UniProt	VAR_043988	G	159	R	TNNC1_HUMAN	Disease (CMD1Z)	---	D	G	159	R
14	UniProt	VAR_019874	R	162	P	TNNI3_HUMAN	Disease (CMH7)	397516354	F	R	162	P
15	UniProt	VAR_042745	R	162	Q	TNNI3_HUMAN	Disease (CMH7)	397516354	F	R	162	Q
16	UniProt	VAR_043984	R	215	L	TNNT2_HUMAN	Disease (CMD1D)	121964860	E	R	205	L
17	UniProt	VAR_042748	I	221	T	TNNT2_HUMAN	Polymorphism	45520032	E	I	211	T
18	UniProt	VAR_057310	I	231	T	TNNT2_HUMAN	Polymorphism	45520032	E	I	221	T
19	UniProt	VAR_013022	S	249	T	TNNT2_HUMAN	Polymorphism	2996495	E	T	239	T
20	UniProt	VAR_007610	E	254	D	TNNT2_HUMAN	Disease (CMH2)	45466197	E	E	244	D
21	UniProt	VAR_007611	K	263	R	TNNT2_HUMAN	Polymorphism	3730238	E	K	253	R
22	UniProt	VAR_029451	N	279	Y	TNNT2_HUMAN	Polymorphism	4523540	E	N	269	Y
23	UniProt	VAR_019879	N	281	I	TNNT2_HUMAN	Disease (CMH2)	863225119	E	N	271	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 14)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	TNNC1_HUMAN	33-51 52-87 92-127 128-161	8	A:33-51 D:33-51 A:52-87 D:52-87 A:92-127 D:92-127 A:128-161 D:128-161
2	EF_HAND_1	PS00018	EF-hand calcium-binding domain.	TNNC1_HUMAN	65-77 105-117 141-153	6	A:65-77 D:65-77 A:105-117 D:105-117 A:141-153 D:141-153

Biological Unit 1 (2, 7)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	TNNC1_HUMAN	33-51 52-87 92-127 128-161	4	A:33-51 - A:52-87 - A:92-127 - A:128-161 -
2	EF_HAND_1	PS00018	EF-hand calcium-binding domain.	TNNC1_HUMAN	65-77 105-117 141-153	3	A:65-77 - A:105-117 - A:141-153 -

Biological Unit 2 (2, 7)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	TNNC1_HUMAN	33-51 52-87 92-127 128-161	4	- D:33-51 - D:52-87 - D:92-127 - D:128-161
2	EF_HAND_1	PS00018	EF-hand calcium-binding domain.	TNNC1_HUMAN	65-77 105-117 141-153	3	- D:65-77 - D:105-117 - D:141-153

Asymmetric Unit (15, 29)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000232975	1	ENSE00001063786	chr3:52488086-52488008	79	TNNC1_HUMAN	1-8	8	2	A:1-8 D:2-8	8 7
1.2b	ENST00000232975	2b	ENSE00000770833	chr3:52486529-52486499	31	TNNC1_HUMAN	9-19	11	2	A:9-19 D:9-19	11 11
1.3	ENST00000232975	3	ENSE00000770832	chr3:52486268-52486122	147	TNNC1_HUMAN	19-68	50	2	A:19-68 D:19-68	50 50
1.4b	ENST00000232975	4b	ENSE00000770831	chr3:52485874-52485760	115	TNNC1_HUMAN	68-106	39	2	A:68-106 (gaps) D:68-106	39 39
1.5c	ENST00000232975	5c	ENSE00000770830	chr3:52485543-52485407	137	TNNC1_HUMAN	106-152	47	2	A:106-152 D:106-152	47 47
1.6	ENST00000232975	6	ENSE00001063787	chr3:52485322-52485118	205	TNNC1_HUMAN	152-161	10	2	A:152-161 D:152-161	10 10

2.2g	ENST00000236918	2g	ENSE00001315772	chr1:201342382-201342342	41	TNNT2_HUMAN	1-14	14	0	-	-
2.3a	ENST00000236918	3a	ENSE00001686085	chr1:201341283-201341273	11	TNNT2_HUMAN	14-18	5	0	-	-
2.4a	ENST00000236918	4a	ENSE00001444197	chr1:201338973-201338944	30	TNNT2_HUMAN	18-28	11	0	-	-
2.5b	ENST00000236918	5b	ENSE00001233153	chr1:201337355-201337290	66	TNNT2_HUMAN	28-50	23	0	-	-
2.6b	ENST00000236918	6b	ENSE00001043765	chr1:201336934-201336899	36	TNNT2_HUMAN	50-62	13	0	-	-
2.7c	ENST00000236918	7c	ENSE00000796482	chr1:201335999-201335966	34	TNNT2_HUMAN	62-73	12	0	-	-
2.7f	ENST00000236918	7f	ENSE00000796481	chr1:201334798-201334738	61	TNNT2_HUMAN	73-93	21	0	-	-
2.8c	ENST00000236918	8c	ENSE00000796480	chr1:201334435-201334319	117	TNNT2_HUMAN	94-132	39	0	-	-
2.9a	ENST00000236918	9a	ENSE00001043748	chr1:201333503-201333426	78	TNNT2_HUMAN	133-158	26	0	-	-
2.9g	ENST00000236918	9g	ENSE00001715169	chr1:201332534-201332424	111	TNNT2_HUMAN	159-195	37	0	-	-
2.10a	ENST00000236918	10a	ENSE00001798058	chr1:201331522-201331514	9	TNNT2_HUMAN	196-198	3	0	-	-
2.11b	ENST00000236918	11b	ENSE00001786343	chr1:201331150-201331041	110	TNNT2_HUMAN	199-235	37	2	B:202-225 E:200-225	24 26
2.12a	ENST00000236918	12a	ENSE00001773452	chr1:201330497-201330407	91	TNNT2_HUMAN	235-265	31	2	B:225-255 E:225-255	31 31
2.13	ENST00000236918	13	ENSE00001709786	chr1:201328791-201328751	41	TNNT2_HUMAN	266-279	14	2	B:256-269 E:256-269	14 14
2.14e	ENST00000236918	14e	ENSE00001749651	chr1:201328383-201328142	242	TNNT2_HUMAN	279-293	15	2	B:269-271 E:269-274	3 6

3.1	ENST00000344887	1	ENSE00001524342	chr19:55669100-55668947	154	TNNI3_HUMAN	1-4	4	0	-	-
3.2	ENST00000344887	2	ENSE00001758167	chr19:55668676-55668664	13	TNNI3_HUMAN	4-8	5	0	-	-
3.3	ENST00000344887	3	ENSE00001250420	chr19:55668501-55668418	84	TNNI3_HUMAN	9-36	28	1	C:35-36 -	2 -
3.4	ENST00000344887	4	ENSE00000727912	chr19:55668012-55667971	42	TNNI3_HUMAN	37-50	14	2	C:37-50 F:37-50	14 14
3.5	ENST00000344887	5	ENSE00000727909	chr19:55667700-55667569	132	TNNI3_HUMAN	51-94	44	2	C:51-94 F:51-94	44 44
3.6	ENST00000344887	6	ENSE00000417663	chr19:55666198-55666109	90	TNNI3_HUMAN	95-124	30	2	C:95-124 F:95-124	30 30
3.7	ENST00000344887	7	ENSE00000856455	chr19:55665574-55665398	177	TNNI3_HUMAN	125-183	59	2	C:125-160 (gaps) F:125-162 (gaps)	36 38
3.8	ENST00000344887	8	ENSE00001250409	chr19:55663285-55663138	148	TNNI3_HUMAN	184-210	27	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:159
 aligned with TNNC1_HUMAN | P63316 from UniProtKB/Swiss-Prot  Length:161

    Alignment length:161
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160 
          TNNC1_HUMAN     1 MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE 161
               SCOP domains d1j1da_ A: Troponin C                                                                                                                                             SCOP domains
               CATH domains ------------1j1dA01 A:13-87 EF-hand                                                    1j  1dA02 A:88-152 EF-hand                                       --------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh.hhhhhhhhhhhhhhhh........hhhhhhhhhhhh....hhhhhhhhhhh.........hhhhhhhhhhhh.....--.hhhhhhhhhhhhh......eehhhhhhhhhhh....hhhhhhhhhhhhh.....eehhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------V--------------------Q------------------------------------------------------Y-------------------------------------------------D----------E-------------R-- SAPs(SNPs)
                PROSITE (1) --------------------------------EF_HAND_2          EF_HAND_2  PDB: A:52-87             ----EF_HAND_2  PDB: A:92-127            EF_HAND_2  PDB: A:128-161          PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------EF_HAND_1    ---------------------------EF_HAND_1    -----------------------EF_HAND_1    -------- PROSITE (2)
           Transcript 1 (1) Exon 1.1Exon 1.2b  ------------------------------------------------Exon 1.4b  PDB: A:68-106 (gaps)        ---------------------------------------------Exon 1.6   Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.3  PDB: A:19-68 UniProt: 19-68             -------------------------------------Exon 1.5c  PDB: A:106-152 UniProt: 106-152     --------- Transcript 1 (2)
                 1j1d A   1 MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDS--KSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE 161
                                    10        20        30        40        50        60        70        80        |- |     100       110       120       130       140       150       160 
                                                                                                                   89 92

Chain B from PDB  Type:PROTEIN  Length:70
 aligned with TNNT2_HUMAN | P45379 from UniProtKB/Swiss-Prot  Length:298

    Alignment length:70
                                   221       231       241       251       261       271       281
          TNNT2_HUMAN   212 QTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDN 281
               SCOP domains d1j1db_ B: Troponin T                                                  SCOP domains
               CATH domains 1j1dB00 B:202-271  [code=1.20.5.350, no name defined]                  CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---L-----T---------T-----------------T----D--------R---------------Y-I SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.11b [INCOMPLETE] ------------------------------Exon 2.13     -- Transcript 2 (1)
           Transcript 2 (2) -----------------------Exon 2.12a  PDB: B:225-255     -------------2.1 Transcript 2 (2)
                 1j1d B 202 QTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQTIYNLEAEKFDLQEKFKQQKYEINVLRNRINDN 271
                                   211       221       231       241       251       261       271

Chain C from PDB  Type:PROTEIN  Length:118
 aligned with TNNI3_HUMAN | P19429 from UniProtKB/Swiss-Prot  Length:210

    Alignment length:126
                                    44        54        64        74        84        94       104       114       124       134       144       154      
          TNNI3_HUMAN    35 AKKKSKISASRKLQLKTLLLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLG 160
               SCOP domains d1j1dc_ C: Troponin I                                                                                                          SCOP domains
               CATH domains 1j1dC01 C:35-146  [code=1.20.5.350, no name defined]                                                            -------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh--------.....hhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) -Q------------------------------------------C--S---------------------------------G----------------------------G-----------V--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------------------------W--------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 3 3.Exon 3.4      Exon 3.5  PDB: C:51-94 UniProt: 51-94       Exon 3.6  PDB: C:95-124       Exon 3.7  PDB: C:125-160 (gaps)      Transcript 3
                 1j1d C  35 AKKKSKISASRKLQLKTLLLQIAKQELEREAEERRGEKGRALSTRAQPLELAGLGFAELQDLARQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLR--------RRVRISADAMMQALLG 160
                                    44        54        64        74        84        94       104       114       124       134 |       -|      154      
                                                                                                                               136      145

Chain D from PDB  Type:PROTEIN  Length:160
 aligned with TNNC1_HUMAN | P63316 from UniProtKB/Swiss-Prot  Length:161

    Alignment length:160
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161
          TNNC1_HUMAN     2 DDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE 161
               SCOP domains d1j1dd_ D: Troponin C                                                                                                                                            SCOP domains
               CATH domains ---1j1dD01 D:5-93 EF-hand                                                                   1j1dD02 D:94-157 EF-hand                                        ---- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhh.hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhh..hhhhhhhhhhhhh.......hhhhhhhhhhhhh.......hhhhhhhhhhhhh.....eeehhhhhhhhhh.....hhhhhhhhhhhhh.....eeehhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------V--------------------Q------------------------------------------------------Y-------------------------------------------------D----------E-------------R-- SAPs(SNPs)
                PROSITE (1) -------------------------------EF_HAND_2          EF_HAND_2  PDB: D:52-87             ----EF_HAND_2  PDB: D:92-127            EF_HAND_2  PDB: D:128-161          PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------EF_HAND_1    ---------------------------EF_HAND_1    -----------------------EF_HAND_1    -------- PROSITE (2)
           Transcript 1 (1) 1.1    Exon 1.2b  ------------------------------------------------Exon 1.4b  PDB: D:68-106               ---------------------------------------------Exon 1.6   Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.3  PDB: D:19-68 UniProt: 19-68             -------------------------------------Exon 1.5c  PDB: D:106-152 UniProt: 106-152     --------- Transcript 1 (2)
                 1j1d D   2 DDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE 161
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161

Chain E from PDB  Type:PROTEIN  Length:75
 aligned with TNNT2_HUMAN | P45379 from UniProtKB/Swiss-Prot  Length:298

    Alignment length:75
                                   219       229       239       249       259       269       279     
          TNNT2_HUMAN   210 KRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKV 284
               SCOP domains d1j1de_ E: Troponin T                                                       SCOP domains
               CATH domains 1j1dE00 E:200-274  [code=1.20.5.350, no name defined]                       CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -----L-----T---------T-----------------T----D--------R---------------Y-I--- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.11b  PDB: E:200-225------------------------------Exon 2.13     ----- Transcript 2 (1)
           Transcript 2 (2) -------------------------Exon 2.12a  PDB: E:225-255     -------------2.14e  Transcript 2 (2)
                 1j1d E 200 KRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQTIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKV 274
                                   209       219       229       239       249       259       269

Chain F from PDB  Type:PROTEIN  Length:116
 aligned with TNNI3_HUMAN | P19429 from UniProtKB/Swiss-Prot  Length:210

    Alignment length:126
                                    46        56        66        76        86        96       106       116       126       136       146       156      
          TNNI3_HUMAN    37 KKSKISASRKLQLKTLLLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGAR 162
               SCOP domains d1j1df_ F: Troponin I                                                                                                          SCOP domains
               CATH domains 1j1dF01 F:37-138  [code=1.20.5.350, no name defined]                                                  ------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.----------.hhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ------------------------------------------C--S---------------------------------G----------------------------------------V----P SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------Q SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 3 Exon 3.4      Exon 3.5  PDB: F:51-94 UniProt: 51-94       Exon 3.6  PDB: F:95-124       Exon 3.7  PDB: F:125-162 (gaps)        Transcript 3
                 1j1d F  37 KKSKISASRKLQLKTLLLQIAKQELEREAEERRGEKGRALSTRAQPLELAGLGFAELQDLARQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGK----------ISADAMMQALLGAR 162
                                    46        56        66        76        86        96       106       116       126       136 |       -  |    156      
                                                                                                                               138        149

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: EF Hand-like (739)

Superfamily: EF-hand (657)

Family: Calmodulin-like (356)

Protein domain: Troponin C (53)

Human (Homo sapiens), cardiac isoform [TaxId: 9606] (16)

1a	d1j1da_	A:
1b	d1j1dd_	D:

Class: Coiled coil proteins (689)

Fold: Parallel coiled-coil (407)

Superfamily: Troponin coil-coiled subunits (8)

Family: Troponin I (4)

Protein domain: Troponin I (4)

Human (Homo sapiens) [TaxId: 9606] (2)

2a	d1j1dc_	C:
2b	d1j1df_	F:

Family: Troponin T (4)

Protein domain: Troponin T (4)

Human (Homo sapiens) [TaxId: 9606] (2)

3a	d1j1db_	B:
3b	d1j1de_	E:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Recoverin; domain 1 (474)

Homologous Superfamily: EF-hand (412)

Human (Homo sapiens) (106)

1a	1j1dA01	A:13-87
1b	1j1dD01	D:5-93
1c	1j1dD02	D:94-157
1d	1j1dA02	A:88-152

Architecture: Up-down Bundle (3216)

Topology: Single alpha-helices involved in coiled-coils or other helix-helix interfaces (552)

Homologous Superfamily: [code=1.20.5.350, no name defined] (3)

Human (Homo sapiens) (2)

2a	1j1dF01	F:37-138
2b	1j1dC01	C:35-146
2c	1j1dE00	E:200-274
2d	1j1dB00	B:202-271

(no "Pfam Domain" information available for 1J1D)

Asymmetric Unit(hide GO term definitions)

Chain A,D (TNNC1_HUMAN | P63316)

molecular function
	GO:0051015	actin filament binding	Interacting selectively and non-covalently with an actin filament, also known as F-actin, a helical filamentous polymer of globular G-actin subunits.
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0048306	calcium-dependent protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules), in the presence of calcium.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0031013	troponin I binding	Interacting selectively and non-covalently with troponin I, the inhibitory subunit of the troponin complex.
	GO:0031014	troponin T binding	Interacting selectively and non-covalently with troponin T, the tropomyosin-binding subunit of the troponin complex.
biological process
	GO:0060048	cardiac muscle contraction	Muscle contraction of cardiac muscle tissue.
	GO:0002086	diaphragm contraction	A process in which force is generated within involuntary skeletal muscle tissue, resulting in a change in muscle geometry. This process occurs in the diaphragm. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. The diaphragm is a striated muscle that is necessary for the process of respiratory gaseous exchange.
	GO:0030049	muscle filament sliding	The sliding of actin thin filaments and myosin thick filaments past each other in muscle contraction. This involves a process of interaction of myosin located on a thick filament with actin located on a thin filament. During this process ATP is split and forces are generated.
	GO:0043462	regulation of ATPase activity	Any process that modulates the rate of ATP hydrolysis by an ATPase.
	GO:0006937	regulation of muscle contraction	Any process that modulates the frequency, rate or extent of muscle contraction.
	GO:0032972	regulation of muscle filament sliding speed	Any process that modulates the velocity of muscle filament sliding.
	GO:0010038	response to metal ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a metal ion stimulus.
	GO:0014883	transition between fast and slow fiber	The process of conversion of fast-contracting muscle fibers to a slower character. This may involve slowing of contractile rate, slow myosin gene induction, increase in oxidative metabolic properties, altered electrophysiology and altered innervation. This process also regulates skeletal muscle adapatation.
	GO:0055010	ventricular cardiac muscle tissue morphogenesis	The process in which the anatomical structures of cardiac ventricle muscle is generated and organized.
cellular component
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0043292	contractile fiber	Fibers, composed of actin, myosin, and associated proteins, found in cells of smooth or striated muscle.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005861	troponin complex	A complex of accessory proteins (typically troponin T, troponin I and troponin C) found associated with actin in muscle thin filaments; involved in calcium regulation of muscle contraction.

Chain B,E (TNNT2_HUMAN | P45379)

molecular function
	GO:0016887	ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0030674	protein binding, bridging	The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
	GO:0005523	tropomyosin binding	Interacting selectively and non-covalently with tropomyosin, a protein associated with actin filaments both in cytoplasm and, in association with troponin, in the thin filament of striated muscle.
	GO:0030172	troponin C binding	Interacting selectively and non-covalently with troponin C, the calcium-binding subunit of the troponin complex.
	GO:0031013	troponin I binding	Interacting selectively and non-covalently with troponin I, the inhibitory subunit of the troponin complex.
biological process
	GO:0051764	actin crosslink formation	The process in which two or more actin filaments are connected together by proteins that act as crosslinks between the filaments. The crosslinked filaments may be on the same or differing axes.
	GO:0060048	cardiac muscle contraction	Muscle contraction of cardiac muscle tissue.
	GO:0006936	muscle contraction	A process in which force is generated within muscle tissue, resulting in a change in muscle geometry. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis.
	GO:0030049	muscle filament sliding	The sliding of actin thin filaments and myosin thick filaments past each other in muscle contraction. This involves a process of interaction of myosin located on a thick filament with actin located on a thin filament. During this process ATP is split and forces are generated.
	GO:0032780	negative regulation of ATPase activity	Any process that stops or reduces the rate of ATP hydrolysis by an ATPase.
	GO:0032781	positive regulation of ATPase activity	Any process that activates or increases the rate of ATP hydrolysis by an ATPase.
	GO:0051291	protein heterooligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers that are not all identical. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0008016	regulation of heart contraction	Any process that modulates the frequency, rate or extent of heart contraction. Heart contraction is the process in which the heart decreases in volume in a characteristic way to propel blood through the body.
	GO:0006937	regulation of muscle contraction	Any process that modulates the frequency, rate or extent of muscle contraction.
	GO:0032972	regulation of muscle filament sliding speed	Any process that modulates the velocity of muscle filament sliding.
	GO:0051592	response to calcium ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
	GO:0055010	ventricular cardiac muscle tissue morphogenesis	The process in which the anatomical structures of cardiac ventricle muscle is generated and organized.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0030016	myofibril	The contractile element of skeletal and cardiac muscle; a long, highly organized bundle of actin, myosin, and other proteins that contracts by a sliding filament mechanism.
	GO:0030017	sarcomere	The repeating unit of a myofibril in a muscle cell, composed of an array of overlapping thick and thin filaments between two adjacent Z discs.
	GO:0005865	striated muscle thin filament	Filaments formed of actin and associated proteins; attached to Z discs at either end of sarcomeres in myofibrils.
	GO:0005861	troponin complex	A complex of accessory proteins (typically troponin T, troponin I and troponin C) found associated with actin in muscle thin filaments; involved in calcium regulation of muscle contraction.

Chain C,F (TNNI3_HUMAN | P19429)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0019855	calcium channel inhibitor activity	Stops, prevents, or reduces the activity of a calcium channel.
	GO:0048306	calcium-dependent protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules), in the presence of calcium.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
	GO:0030172	troponin C binding	Interacting selectively and non-covalently with troponin C, the calcium-binding subunit of the troponin complex.
	GO:0031014	troponin T binding	Interacting selectively and non-covalently with troponin T, the tropomyosin-binding subunit of the troponin complex.
biological process
	GO:0060048	cardiac muscle contraction	Muscle contraction of cardiac muscle tissue.
	GO:0006874	cellular calcium ion homeostasis	Any process involved in the maintenance of an internal steady state of calcium ions at the level of a cell.
	GO:0060047	heart contraction	The multicellular organismal process in which the heart decreases in volume in a characteristic way to propel blood through the body.
	GO:0007507	heart development	The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0030049	muscle filament sliding	The sliding of actin thin filaments and myosin thick filaments past each other in muscle contraction. This involves a process of interaction of myosin located on a thick filament with actin located on a thin filament. During this process ATP is split and forces are generated.
	GO:0032780	negative regulation of ATPase activity	Any process that stops or reduces the rate of ATP hydrolysis by an ATPase.
	GO:1903779	regulation of cardiac conduction	Any process that modulates the frequency, rate or extent of cardiac conduction.
	GO:0006937	regulation of muscle contraction	Any process that modulates the frequency, rate or extent of muscle contraction.
	GO:0006940	regulation of smooth muscle contraction	Any process that modulates the frequency, rate or extent of smooth muscle contraction.
	GO:0001980	regulation of systemic arterial blood pressure by ischemic conditions	The process that modulates blood pressure by the detection of carbon dioxide levels in the brain stem. Increased levels activate the sympathetic vasoconstrictor mechanism increasing the force with which blood flows through the circulatory system.
	GO:0003009	skeletal muscle contraction	A process in which force is generated within skeletal muscle tissue, resulting in a change in muscle geometry. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. In the skeletal muscle, the muscle contraction takes advantage of an ordered sarcomeric structure and in most cases it is under voluntary control.
	GO:0006941	striated muscle contraction	A process in which force is generated within striated muscle tissue, resulting in the shortening of the muscle. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. Striated muscle is a type of muscle in which the repeating units (sarcomeres) of the contractile myofibrils are arranged in registry throughout the cell, resulting in transverse or oblique striations observable at the level of the light microscope.
	GO:0001570	vasculogenesis	The differentiation of endothelial cells from progenitor cells during blood vessel development, and the de novo formation of blood vessels and tubes.
	GO:0055010	ventricular cardiac muscle tissue morphogenesis	The process in which the anatomical structures of cardiac ventricle muscle is generated and organized.
cellular component
	GO:0043292	contractile fiber	Fibers, composed of actin, myosin, and associated proteins, found in cells of smooth or striated muscle.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0030016	myofibril	The contractile element of skeletal and cardiac muscle; a long, highly organized bundle of actin, myosin, and other proteins that contracts by a sliding filament mechanism.
	GO:0030017	sarcomere	The repeating unit of a myofibril in a muscle cell, composed of an array of overlapping thick and thin filaments between two adjacent Z discs.
	GO:0005861	troponin complex	A complex of accessory proteins (typically troponin T, troponin I and troponin C) found associated with actin in muscle thin filaments; involved in calcium regulation of muscle contraction.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1j1d)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1j1d
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TNNC1_HUMAN \| P63316
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TNNI3_HUMAN \| P19429
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TNNT2_HUMAN \| P45379
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	115195
		Disease Information	:	OMIM
	115210
		Disease Information	:	OMIM
	601494
		Disease Information	:	OMIM
	611879
		Disease Information	:	OMIM
	613243
		Disease Information	:	OMIM
	613286
		Disease Information	:	OMIM
	613690
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	TNNC1_HUMAN \| P63316
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TNNI3_HUMAN \| P19429
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TNNT2_HUMAN \| P45379
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1j1e	52KD DOMAIN OF THE SAME PROTEIN AT 3.3 ANGSTROM

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (23, 41)

PROSITE Motifs (2, 14)

Exons (15, 29)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 6)

CATH Domains (2, 8)

Pfam Domains (0, 0)

Gene Ontology (51, 76)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File