Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  TUBULIN-NSC 613862: RB3 STATHMIN-LIKE DOMAIN COMPLEX
 
Authors :  P. Barbier, A. Dorleans, F. Devred, L. Sanz, D. Allegro, C. Alfonso, M. K V. Peyrot, J. M. Andreu
Date :  18 May 10  (Deposition) - 28 Jul 10  (Release) - 20 Oct 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  4.00
Chains :  Asym./Biol. Unit :  A,B,C,D,E
Keywords :  Alpha-Tubulin, Beta-Tubulin, Colchicine Domain, Covalent Binding, Microtubule, Stathmin, Tubulin, Cell Cycle (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  P. Barbier, A. Dorleans, F. Devred, L. Sanz, D. Allegro, C. Alfonso, M. Knossow, V. Peyrot, J. M. Andreu
Stathmin And Interfacial Microtubule Inhibitors Recognize A Naturally Curved Conformation Of Tubulin Dimers.
J. Biol. Chem. V. 285 31672 2010
PubMed-ID: 20675373  |  Reference-DOI: 10.1074/JBC.M110.141929

(-) Compounds

Molecule 1 - TUBULIN ALPHA CHAIN
    ChainsA, C
    OrganBRAIN
    Organism CommonSHEEP
    Organism ScientificOVIS ARIES
    Organism Taxid9940
 
Molecule 2 - TUBULIN BETA CHAIN
    ChainsB, D
    OrganBRAIN
    Organism CommonSHEEP
    Organism ScientificOVIS ARIES
    Organism Taxid9940
 
Molecule 3 - STATHMIN-4
    ChainsE
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-8C
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 49-189
    GeneSTMN4
    Organism CommonRAT
    Organism ScientificRATTUS NORVEGICUS
    Organism Taxid10116
    SynonymSTATHMIN-LIKE PROTEIN B3, RB3

 Structural Features

(-) Chains, Units

  12345
Asymmetric/Biological Unit ABCDE

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 9)

Asymmetric/Biological Unit (4, 9)
No.NameCountTypeFull Name
1GDP2Ligand/IonGUANOSINE-5'-DIPHOSPHATE
2GTP2Ligand/IonGUANOSINE-5'-TRIPHOSPHATE
3K2N2Ligand/IonETHYL [(2S)-5-AMINO-2-METHYL-3-PHENYL-1,2-DIHYDROPYRIDO[3,4-B]PYRAZIN-7-YL]CARBAMATE
4MG3Ligand/IonMAGNESIUM ION

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:10 , GLN A:11 , ALA A:12 , GLN A:15 , ASP A:69 , GLU A:71 , ASP A:98 , SER A:140 , GLY A:142 , GLY A:144 , THR A:145 , GLY A:146 , PRO A:173 , VAL A:177 , SER A:178 , GLU A:183 , ASN A:206 , TYR A:224 , ASN A:228 , MG A:601 , LYS B:254BINDING SITE FOR RESIDUE GTP A 600
2AC2SOFTWAREASP A:98 , ALA A:99 , GLY A:144 , THR A:145 , GTP A:600BINDING SITE FOR RESIDUE MG A 601
3AC3SOFTWAREGLN B:11 , CYS B:12 , SER B:140 , GLY B:142 , GLY B:143 , GLY B:144 , THR B:145 , GLY B:146 , PRO B:173 , VAL B:177 , ASP B:179 , GLU B:183 , ASN B:206 , TYR B:224 , ASN B:228 , MG B:601BINDING SITE FOR RESIDUE GDP B 600
4AC4SOFTWAREGLN B:11 , ASN B:101 , GDP B:600BINDING SITE FOR RESIDUE MG B 601
5AC5SOFTWAREGLN B:136 , ASN B:167 , GLU B:200 , TYR B:202 , VAL B:238 , CYS B:241 , LEU B:242 , LEU B:252 , LEU B:255 , MET B:259 , ALA B:316 , VAL B:318 , ILE B:378BINDING SITE FOR RESIDUE K2N B 700
6AC6SOFTWAREGLN C:11 , ALA C:12 , ASP C:69 , GLU C:71 , ASP C:98 , SER C:140 , GLY C:142 , GLY C:143 , GLY C:144 , THR C:145 , GLY C:146 , PRO C:173 , VAL C:177 , ASN C:206 , TYR C:224 , ASN C:228 , ILE C:231 , MG C:601 , LYS D:254BINDING SITE FOR RESIDUE GTP C 600
7AC7SOFTWAREASP C:98 , ALA C:99 , ALA C:100 , ASN C:101 , GLY C:144 , THR C:145 , GTP C:600 , LYS D:254BINDING SITE FOR RESIDUE MG C 601
8AC8SOFTWAREGLN D:11 , CYS D:12 , ILE D:16 , ASN D:101 , SER D:140 , GLY D:142 , GLY D:143 , GLY D:144 , THR D:145 , GLY D:146 , VAL D:177 , SER D:178 , ASP D:179 , GLU D:183 , ASN D:206 , TYR D:224 , LEU D:227 , ASN D:228BINDING SITE FOR RESIDUE GDP D 600
9AC9SOFTWAREGLU D:200 , TYR D:202 , VAL D:238 , LEU D:242 , LEU D:248 , LEU D:252 , LEU D:255 , MET D:259 , ALA D:316 , VAL D:318 , ILE D:378BINDING SITE FOR RESIDUE K2N D 700

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3N2K)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3N2K)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3N2K)

(-) PROSITE Motifs  (3, 3)

Asymmetric/Biological Unit (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1STATHMIN_3PS51663 Stathmin-like (SLD) domain profile.STMN4_RAT48-189  1E:5-140
2STATHMIN_1PS00563 Stathmin family signature 1.STMN4_RAT84-93  1E:45-49
3STATHMIN_2PS01041 Stathmin family signature 2.STMN4_RAT117-126  1E:73-82

(-) Exons   (0, 0)

(no "Exon" information available for 3N2K)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:428
 aligned with D0VWZ0_SHEEP | D0VWZ0 from UniProtKB/TrEMBL  Length:451

    Alignment length:437
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       
         D0VWZ0_SHEEP     2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeehhhhhhhhhhhhhhhhhhh.........---------..................eeee....hhhhhhh........hhh.ee........hhhhhhh.hhhhhhhhhhhhhhhhhhh...eeeeeeeee..hhhhhhhhhhhhhhhhhhh....eeeeee..........hhhhhhhhhhhhhhh...eeee.hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhh........ee................hhhhhhhhhhhhhhh..........eeeeeeeeee..hhhhhhhhhhhhhh..............eeeee................ee...eeee...hhhhhhhhhhhhhhhh....hhhhhhhh.hhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3n2k A   2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMP---------DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438
                                    11        21        31     |   -     |  51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       
                                                              37        47                                                                                                                                                                                                                                                                                                                                                                                                       

Chain B from PDB  Type:PROTEIN  Length:420
 aligned with D0VWY9_SHEEP | D0VWY9 from UniProtKB/TrEMBL  Length:445

    Alignment length:428
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421        
         D0VWY9_SHEEP     2 REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeehhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhh...........eeee..hhhhhhhhh...hhhhhhhh.ee........hhhhhhhhhhhh.hhhhhhhhhhhhh......eeeeeee..hhhhhhhhhhhhhhhh........eeeeee.........hhhhhhhhhhhhhh....eeeeeehhhhhhhhhh...........hhhhhhhhhhhhhhhhh........hhhhhhh..........eeee.....--------..hhhhhhhhh...............eeeeeeeee......hhhhhhhhhhhhh...........eeeeee.........eeeeeeee..hhhhhhhhhhhhhhhhh....hhhhhh...hhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3n2k B   2 REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTS--------LTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 439
                                    11        21        31        41  ||    53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273   |     -  |    293       303       313       323       333       343       353      |371       381       391       401       411       421       431        
                                                                     44|                                                                                                                                                                                                                                   277      286                                                                       360|                                                                      
                                                                      47                                                                                                                                                                                                                                                                                                                       369                                                                      

Chain C from PDB  Type:PROTEIN  Length:429
 aligned with D0VWZ0_SHEEP | D0VWZ0 from UniProtKB/TrEMBL  Length:451

    Alignment length:437
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       
         D0VWZ0_SHEEP     2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -Tubulin-3n2kC01 C:3-226                                                                                                                                                                                                         ------------------------------------Tubulin_C-3n2kC03      C:263-393                                                                                                   --------------------------------------------- Pfam domains (1)
           Pfam domains (2) -Tubulin-3n2kC02 C:3-226                                                                                                                                                                                                         ------------------------------------Tubulin_C-3n2kC04      C:263-393                                                                                                   --------------------------------------------- Pfam domains (2)
         Sec.struct. author .eeeeeeehhhhhhhhhhhhhhhhhhh...............---..................eeee.....hhhhh.........hhh.ee........hhhhhhh.hhhhhhhhhhhhhhhhhhh...eeeeeeeee..hhhhhhhhhhhhhhhhhhh....eeeeeee.hhhhh...hhhhhhhhhhhhhh....eeeeeehhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh......hhhhhhh...........ee.........-----..hhhhhhh...hhhhh..........eeeeeeeeee..hhhhhhhhhhhhhh..............eeeee................ee...eeee...hhhhhhhhhhhhhhhh....hhhhhhhh.hhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3n2k C   2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIG---DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAE-----QLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438
                                    11        21        31        41 |   |  51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       | -   |   291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       
                                                                    43  47                                                                                                                                                                                                                                     279   285                                                                                                                                                         

Chain D from PDB  Type:PROTEIN  Length:427
 aligned with D0VWY9_SHEEP | D0VWY9 from UniProtKB/TrEMBL  Length:445

    Alignment length:427
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       
         D0VWY9_SHEEP     2 REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 428
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -Tubulin-3n2kD01 D:3-226                                                                                                                                                                                                       ------------------------------------Tubulin_C-3n2kD03 D:263-393                                                                                                --------------------------------------------- Pfam domains (1)
           Pfam domains (2) -Tubulin-3n2kD02 D:3-226                                                                                                                                                                                                       ------------------------------------Tubulin_C-3n2kD04 D:263-393                                                                                                --------------------------------------------- Pfam domains (2)
         Sec.struct. author ..eeeeeehhhhhhhhhhhhhhhhhhhh............hhhhhhhhhh...........eeee..hhhhhhhhh...hhhhhhhh.ee........hhhhhhh......hhhhhhhhhhhhhhh....eeeeeee..hhhhhhhhhhhhhhhh.........eeee..........hhhhhhhhhhhhhhhhh..eee.hhhhhhhhhhh...........hhhhhhhhhhhhhhhhh........hhhhhhh............ee...............hhhhhh...hhhhh..........eeeeeeeee...hhhhhhhhhhhhhhhh...........eeeeee.........eeeeeeee..hhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3n2k D   2 REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 438
                                    11        21        31        41  ||    53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353      |371       381       391       401       411       421       431       
                                                                     44|                                                                                                                                                                                                                                                                                                                      360|                                                                     
                                                                      47                                                                                                                                                                                                                                                                                                                       369                                                                     

Chain E from PDB  Type:PROTEIN  Length:123
 aligned with STMN4_RAT | P63043 from UniProtKB/Swiss-Prot  Length:189

    Alignment length:137
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       
            STMN4_RAT    48 SDMEVIELNKCTSGQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKNKELK 184
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -Stathmin-3n2kE01 E:5-140                                                                                                                 Pfam domains
         Sec.struct. author .............eeeee.........--------------...........hhhhhhhhhhh...........hhhhhhhhhhhhhhhhhh..hhhhhh...hhhhhhhhhhhhhhh.hhhhhh............ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) STATHMIN_3  PDB: E:5-140 UniProt: 48-189                                                                                                  PROSITE (1)
                PROSITE (2) ------------------------------------STATHMIN_1-----------------------STATHMIN_2---------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3n2k E   4 ADMEVIELNKCTSGQSFEVILKPPSFD--------------PSLEEIQKKLEAAEERRKYQEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKNKELK 140
                                    13        23      |  -         - |      53        63        73        83        93       103       113       123       133       
                                                     30             45                                                                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3N2K)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3N2K)

(-) Pfam Domains  (3, 9)

Asymmetric/Biological Unit

(-) Gene Ontology  (18, 27)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,C   (D0VWZ0_SHEEP | D0VWZ0)
molecular function
    GO:0005525    GTP binding    Interacting selectively and non-covalently with GTP, guanosine triphosphate.
    GO:0003924    GTPase activity    Catalysis of the reaction: GTP + H2O = GDP + phosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005200    structural constituent of cytoskeleton    The action of a molecule that contributes to the structural integrity of a cytoskeletal structure.
biological process
    GO:0007017    microtubule-based process    Any cellular process that depends upon or alters the microtubule cytoskeleton, that part of the cytoskeleton comprising microtubules and their associated proteins.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005874    microtubule    Any of the long, generally straight, hollow tubes of internal diameter 12-15 nm and external diameter 24 nm found in a wide variety of eukaryotic cells; each consists (usually) of 13 protofilaments of polymeric tubulin, staggered in such a manner that the tubulin monomers are arranged in a helical pattern on the microtubular surface, and with the alpha/beta axes of the tubulin subunits parallel to the long axis of the tubule; exist in equilibrium with pool of tubulin monomers and can be rapidly assembled or disassembled in response to physiological stimuli; concerned with force generation, e.g. in the spindle.

Chain B,D   (D0VWY9_SHEEP | D0VWY9)
molecular function
    GO:0005525    GTP binding    Interacting selectively and non-covalently with GTP, guanosine triphosphate.
    GO:0003924    GTPase activity    Catalysis of the reaction: GTP + H2O = GDP + phosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005200    structural constituent of cytoskeleton    The action of a molecule that contributes to the structural integrity of a cytoskeletal structure.
biological process
    GO:0007017    microtubule-based process    Any cellular process that depends upon or alters the microtubule cytoskeleton, that part of the cytoskeleton comprising microtubules and their associated proteins.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005874    microtubule    Any of the long, generally straight, hollow tubes of internal diameter 12-15 nm and external diameter 24 nm found in a wide variety of eukaryotic cells; each consists (usually) of 13 protofilaments of polymeric tubulin, staggered in such a manner that the tubulin monomers are arranged in a helical pattern on the microtubular surface, and with the alpha/beta axes of the tubulin subunits parallel to the long axis of the tubule; exist in equilibrium with pool of tubulin monomers and can be rapidly assembled or disassembled in response to physiological stimuli; concerned with force generation, e.g. in the spindle.

Chain E   (STMN4_RAT | P63043)
molecular function
    GO:0015631    tubulin binding    Interacting selectively and non-covalently with monomeric or multimeric forms of tubulin, including microtubules.
biological process
    GO:0007019    microtubule depolymerization    The removal of tubulin heterodimers from one or both ends of a microtubule.
    GO:0031175    neuron projection development    The process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
    GO:0051493    regulation of cytoskeleton organization    Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures.
    GO:0031110    regulation of microtubule polymerization or depolymerization    Any process that modulates the frequency, rate or extent of microtubule polymerization or depolymerization by the addition or removal of tubulin heterodimers from a microtubule.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0030424    axon    The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
    GO:0042995    cell projection    A prolongation or process extending from a cell, e.g. a flagellum or axon.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0030426    growth cone    The migrating motile tip of a growing nerve cell axon or dendrite.
    GO:0043005    neuron projection    A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GTP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K2N  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3n2k)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3n2k
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  D0VWY9_SHEEP | D0VWY9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
  D0VWZ0_SHEEP | D0VWZ0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
  STMN4_RAT | P63043
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  D0VWY9_SHEEP | D0VWY9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  D0VWZ0_SHEEP | D0VWZ0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  STMN4_RAT | P63043
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        STMN4_RAT | P630431sa0 1sa1 1z2b 3du7 3e22 3hkb 3hkc 3hkd 3hke 3n2g 3ryc 3ryf 3ryh 3ryi 3ut5 4eb6 4i4t 4i50 4i55 4ihj 4iij 4o2a 4o2b 4o4h 4o4i 4o4j 4o4l 4tuy 4tv8 4tv9 4wbn 4x1i 4x1k 4x1y 4x20 4yj2 4yj3 4zhq 4zi7 4zol 5bmv 5c8y 5ca0 5ca1 5cb4 5ezy 5fnv 5gon 5iyz 5j2t 5j2u 5jh7 5jqg 5jvd 5kx5 5la6 5lov 5lp6 5lxt 5lyj 5m7e 5m7g 5m8d 5m8g 5njh 5o7a
UniProtKB/TrEMBL
        D0VWY9_SHEEP | D0VWY93hkb 3hkc 3hkd 3hke 3n2g 3ryc 3ryf 3ryh 3ryi 3ut5 4drx 4eb6 4f61 4f6r 4hna 4lnu 4x1i 4x1k 4x1y 4x20 5eyp 5kx5
        D0VWZ0_SHEEP | D0VWZ03hkb 3hkc 3hkd 3hke 3n2g 3ryc 3ryf 3ryh 3ryi 3ut5 4drx 4eb6 4f61 4f6r 4hna 4x1i 4x1k 4x1y 4x20 5eyp 5kx5

(-) Related Entries Specified in the PDB File

3n2g