|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 20)
|
Asymmetric Unit (20, 20)
|
Asymmetric Unit
|
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 3CM2) |
Asymmetric Unit (2, 20)
|
Asymmetric Unit (4, 40)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:103 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot Length:497 Alignment length:103 262 272 282 292 302 312 322 332 342 352 XIAP_HUMAN 253 STNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 SCOP domains d3cm2a_ A: BIR domains of XIAP SCOP domains CATH domains 3cm2A00 A:253-355 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ------------BIR_REPEAT_1 PDB: A:265-330 UniProt: 265-330 ------------------------- PROSITE (1) PROSITE (2) ---------------BIR_REPEAT_2 PDB: A:268-331 UniProt: 268-331 ------------------------ PROSITE (2) Transcript 1 (1) Exon 1.3c PDB: A:253-293 UniProt: 1-293 --------------------------------Exon 1.5b PDB: A:326-352 1.6 Transcript 1 (1) Transcript 1 (2) ----------------------------------------Exon 1.4b PDB: A:293-326 ----------------------------- Transcript 1 (2) 3cm2 A 253 STNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 262 272 282 292 302 312 322 332 342 352 Chain B from PDB Type:PROTEIN Length:103 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot Length:497 Alignment length:103 262 272 282 292 302 312 322 332 342 352 XIAP_HUMAN 253 STNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 SCOP domains d3cm2b_ B: BIR domains of XIAP SCOP domains CATH domains 3cm2B00 B:253-355 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ------------BIR_REPEAT_1 PDB: B:265-330 UniProt: 265-330 ------------------------- PROSITE (1) PROSITE (2) ---------------BIR_REPEAT_2 PDB: B:268-331 UniProt: 268-331 ------------------------ PROSITE (2) Transcript 1 (1) Exon 1.3c PDB: B:253-293 UniProt: 1-293 --------------------------------Exon 1.5b PDB: B:326-352 1.6 Transcript 1 (1) Transcript 1 (2) ----------------------------------------Exon 1.4b PDB: B:293-326 ----------------------------- Transcript 1 (2) 3cm2 B 253 STNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 262 272 282 292 302 312 322 332 342 352 Chain C from PDB Type:PROTEIN Length:102 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot Length:497 Alignment length:102 262 272 282 292 302 312 322 332 342 352 XIAP_HUMAN 253 STNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVR 354 SCOP domains d3cm2c_ C: BIR domains of XIAP SCOP domains CATH domains 3cm2C00 C:253-354 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) ------------BIR_REPEAT_1 PDB: C:265-330 UniProt: 265-330 ------------------------ PROSITE (1) PROSITE (2) ---------------BIR_REPEAT_2 PDB: C:268-331 UniProt: 268-331 ----------------------- PROSITE (2) Transcript 1 (1) Exon 1.3c PDB: C:253-293 UniProt: 1-293 --------------------------------Exon 1.5b PDB: C:326-352 1. Transcript 1 (1) Transcript 1 (2) ----------------------------------------Exon 1.4b PDB: C:293-326 ---------------------------- Transcript 1 (2) 3cm2 C 253 STNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVR 354 262 272 282 292 302 312 322 332 342 352 Chain D from PDB Type:PROTEIN Length:102 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot Length:497 Alignment length:102 263 273 283 293 303 313 323 333 343 353 XIAP_HUMAN 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 SCOP domains d3cm2d_ D: BIR domains of XIAP SCOP domains CATH domains 3cm2D00 D:254-355 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) -----------BIR_REPEAT_1 PDB: D:265-330 UniProt: 265-330 ------------------------- PROSITE (1) PROSITE (2) --------------BIR_REPEAT_2 PDB: D:268-331 UniProt: 268-331 ------------------------ PROSITE (2) Transcript 1 (1) Exon 1.3c PDB: D:254-293 UniProt: 1-293--------------------------------Exon 1.5b PDB: D:326-352 1.6 Transcript 1 (1) Transcript 1 (2) ---------------------------------------Exon 1.4b PDB: D:293-326 ----------------------------- Transcript 1 (2) 3cm2 D 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 263 273 283 293 303 313 323 333 343 353 Chain E from PDB Type:PROTEIN Length:102 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot Length:497 Alignment length:102 263 273 283 293 303 313 323 333 343 353 XIAP_HUMAN 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 SCOP domains d3cm2e_ E: BIR domains of XIAP SCOP domains CATH domains 3cm2E00 E:254-355 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) -----------BIR_REPEAT_1 PDB: E:265-330 UniProt: 265-330 ------------------------- PROSITE (1) PROSITE (2) --------------BIR_REPEAT_2 PDB: E:268-331 UniProt: 268-331 ------------------------ PROSITE (2) Transcript 1 (1) Exon 1.3c PDB: E:254-293 UniProt: 1-293--------------------------------Exon 1.5b PDB: E:326-352 1.6 Transcript 1 (1) Transcript 1 (2) ---------------------------------------Exon 1.4b PDB: E:293-326 ----------------------------- Transcript 1 (2) 3cm2 E 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 263 273 283 293 303 313 323 333 343 353 Chain F from PDB Type:PROTEIN Length:103 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot Length:497 Alignment length:103 262 272 282 292 302 312 322 332 342 352 XIAP_HUMAN 253 STNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 SCOP domains d3cm2f_ F: BIR domains of XIAP SCOP domains CATH domains 3cm2F00 F:253-355 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ------------BIR_REPEAT_1 PDB: F:265-330 UniProt: 265-330 ------------------------- PROSITE (1) PROSITE (2) ---------------BIR_REPEAT_2 PDB: F:268-331 UniProt: 268-331 ------------------------ PROSITE (2) Transcript 1 (1) Exon 1.3c PDB: F:253-293 UniProt: 1-293 --------------------------------Exon 1.5b PDB: F:326-352 1.6 Transcript 1 (1) Transcript 1 (2) ----------------------------------------Exon 1.4b PDB: F:293-326 ----------------------------- Transcript 1 (2) 3cm2 F 253 STNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 262 272 282 292 302 312 322 332 342 352 Chain G from PDB Type:PROTEIN Length:102 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot Length:497 Alignment length:102 263 273 283 293 303 313 323 333 343 353 XIAP_HUMAN 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 SCOP domains d3cm2g_ G: BIR domains of XIAP SCOP domains CATH domains 3cm2G00 G:254-355 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) -----------BIR_REPEAT_1 PDB: G:265-330 UniProt: 265-330 ------------------------- PROSITE (1) PROSITE (2) --------------BIR_REPEAT_2 PDB: G:268-331 UniProt: 268-331 ------------------------ PROSITE (2) Transcript 1 (1) Exon 1.3c PDB: G:254-293 UniProt: 1-293--------------------------------Exon 1.5b PDB: G:326-352 1.6 Transcript 1 (1) Transcript 1 (2) ---------------------------------------Exon 1.4b PDB: G:293-326 ----------------------------- Transcript 1 (2) 3cm2 G 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 263 273 283 293 303 313 323 333 343 353 Chain H from PDB Type:PROTEIN Length:102 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot Length:497 Alignment length:102 263 273 283 293 303 313 323 333 343 353 XIAP_HUMAN 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 SCOP domains d3cm2h_ H: BIR domains of XIAP SCOP domains CATH domains 3cm2H00 H:254-355 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) -----------BIR_REPEAT_1 PDB: H:265-330 UniProt: 265-330 ------------------------- PROSITE (1) PROSITE (2) --------------BIR_REPEAT_2 PDB: H:268-331 UniProt: 268-331 ------------------------ PROSITE (2) Transcript 1 (1) Exon 1.3c PDB: H:254-293 UniProt: 1-293--------------------------------Exon 1.5b PDB: H:326-352 1.6 Transcript 1 (1) Transcript 1 (2) ---------------------------------------Exon 1.4b PDB: H:293-326 ----------------------------- Transcript 1 (2) 3cm2 H 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 263 273 283 293 303 313 323 333 343 353 Chain I from PDB Type:PROTEIN Length:102 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot Length:497 Alignment length:102 263 273 283 293 303 313 323 333 343 353 XIAP_HUMAN 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 SCOP domains d3cm2i_ I: BIR domains of XIAP SCOP domains CATH domains 3cm2I00 I:254-355 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) -----------BIR_REPEAT_1 PDB: I:265-330 UniProt: 265-330 ------------------------- PROSITE (1) PROSITE (2) --------------BIR_REPEAT_2 PDB: I:268-331 UniProt: 268-331 ------------------------ PROSITE (2) Transcript 1 (1) Exon 1.3c PDB: I:254-293 UniProt: 1-293--------------------------------Exon 1.5b PDB: I:326-352 1.6 Transcript 1 (1) Transcript 1 (2) ---------------------------------------Exon 1.4b PDB: I:293-326 ----------------------------- Transcript 1 (2) 3cm2 I 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRT 355 263 273 283 293 303 313 323 333 343 353 Chain J from PDB Type:PROTEIN Length:103 aligned with XIAP_HUMAN | P98170 from UniProtKB/Swiss-Prot Length:497 Alignment length:103 263 273 283 293 303 313 323 333 343 353 XIAP_HUMAN 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 356 SCOP domains d3cm2j_ J: BIR domains of XIAP SCOP domains CATH domains 3cm2J00 J:254-356 Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------BIR_REPEAT_1 PDB: J:265-330 UniProt: 265-330 -------------------------- PROSITE (1) PROSITE (2) --------------BIR_REPEAT_2 PDB: J:268-331 UniProt: 268-331 ------------------------- PROSITE (2) Transcript 1 (1) Exon 1.3c PDB: J:254-293 UniProt: 1-293--------------------------------Exon 1.5b PDB: J:326-352 1.6 Transcript 1 (1) Transcript 1 (2) ---------------------------------------Exon 1.4b PDB: J:293-326 ------------------------------ Transcript 1 (2) 3cm2 J 254 TNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT 356 263 273 283 293 303 313 323 333 343 353
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 3CM2) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D,E,F,G,H,I,J (XIAP_HUMAN | P98170)
|
|
|
|
|
|
|