Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF INLA S192N Y369S/MEC1 COMPLEX
 
Authors :  T. Wollert, D. W. Heinz, W. D. Schubert
Date :  23 Jan 07  (Deposition) - 05 Jun 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.85
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Leucine-Rich-Repeat, Invasion Protein, Ig-Like Domain, Adhesion Protein, Cell Invasion-Cell Adhesion Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Wollert, B. Pasche, M. Rochon, S. Deppenmeier, J. Van Den Heuvel, A. D. Gruber, D. W. Heinz, A. Lengeling, W. D. Schubert
Extending The Host Range Of Listeria Monocytogenes By Rational Protein Design.
Cell(Cambridge, Mass. ) V. 129 891 2007
PubMed-ID: 17540170  |  Reference-DOI: 10.1016/J.CELL.2007.03.049

(-) Compounds

Molecule 1 - INTERNALIN-A
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidPGEX
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    FragmentINTERNALIN DOMAIN
    GeneINLA
    MutationYES
    Organism ScientificLISTERIA MONOCYTOGENES
    Organism Taxid169963
    StrainEGD-E
 
Molecule 2 - EPITHELIAL-CADHERIN
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidPGEX
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    FragmentN-TERMINAL DOMAIN OF MURINE E-CADHERIN
    GeneCDH1
    Organism CommonHOUSE MOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    StrainC57BL/6J

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 5)

Asymmetric/Biological Unit (1, 5)
No.NameCountTypeFull Name
1CL5Ligand/IonCHLORIDE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:325 , HOH A:1065 , HOH B:130BINDING SITE FOR RESIDUE CL A 973
2AC2SOFTWARETYR A:347 , PHE A:367 , SER A:369 , SER A:389BINDING SITE FOR RESIDUE CL A 974
3AC3SOFTWARELYS A:56 , GLN A:82 , HOH A:1203BINDING SITE FOR RESIDUE CL A 975
4AC4SOFTWARETHR A:408 , GLN A:409 , LYS A:481 , GLY A:482 , THR A:483 , HOH A:1081 , HOH A:1134 , PRO B:-2BINDING SITE FOR RESIDUE CL A 972
5AC5SOFTWARETHR A:49 , HOH A:1092 , HOH A:1343 , HOH A:1700 , HOH A:1703 , HOH A:1708 , HOH A:1711BINDING SITE FOR RESIDUE CL A 971

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2OMW)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Gly A:194 -Asn A:195
2Glu A:455 -Pro A:456
3Phe B:17 -Pro B:18
4Pro B:46 -Pro B:47

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (15, 15)

Asymmetric/Biological Unit (15, 15)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_INLA_LISMO_003 *T51AINLA_LISMO  ---  ---AT51A
02UniProtVAR_INLA_LISMO_004 *V94LINLA_LISMO  ---  ---AV94L
03UniProtVAR_INLA_LISMO_005 *N118DINLA_LISMO  ---  ---AN118D
04UniProtVAR_INLA_LISMO_006 *T142SINLA_LISMO  ---  ---AT142S
05UniProtVAR_INLA_LISMO_007 *S187NINLA_LISMO  ---  ---AS187N
06UniProtVAR_INLA_LISMO_008 *F193LINLA_LISMO  ---  ---AF193L
07UniProtVAR_INLA_LISMO_009 *L253WINLA_LISMO  ---  ---AL253W
08UniProtVAR_INLA_LISMO_010 *S292PINLA_LISMO  ---  ---AS292P
09UniProtVAR_INLA_LISMO_011 *S292RINLA_LISMO  ---  ---AS292R
10UniProtVAR_INLA_LISMO_012 *N321SINLA_LISMO  ---  ---AN321S
11UniProtVAR_INLA_LISMO_013 *N381SINLA_LISMO  ---  ---AN381S
12UniProtVAR_INLA_LISMO_014 *A416EINLA_LISMO  ---  ---AA416E
13UniProtVAR_INLA_LISMO_015 *T454AINLA_LISMO  ---  ---AT454A
14UniProtVAR_INLA_LISMO_016 *S474NINLA_LISMO  ---  ---AS474N
15UniProtVAR_INLA_LISMO_017 *P476SINLA_LISMO  ---  ---AP476S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 18)

Asymmetric/Biological Unit (3, 18)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LRRPS51450 Leucine-rich repeat profile.INLA_LISM499-120
77-98
121-142
143-164
165-186
187-207
208-229
230-251
252-273
274-295
296-317
318-339
340-361
362-383
384-405
  15A:99-120
A:77-98
A:121-142
A:143-164
A:165-186
A:188-207
A:208-229
A:230-251
A:252-273
A:274-295
A:296-317
A:318-339
A:340-361
A:362-383
A:384-405
INLA_LISMO99-120
121-142
143-164
165-186
187-207
208-229
230-251
252-273
274-295
296-317
318-339
340-361
362-383
384-405
  14A:99-120
A:121-142
A:143-164
A:165-186
A:187-207
A:208-229
A:230-251
A:252-273
A:274-295
A:296-317
A:318-339
A:340-361
A:362-383
A:384-405
2CADHERIN_2PS50268 Cadherins domain profile.CADH1_MOUSE182-264
265-377
378-488
489-597
  1B:26-100
-
-
-
3CADHERIN_1PS00232 Cadherin domain signature.CADH1_MOUSE252-262
365-375
585-595
  1B:96-100
-
-

(-) Exons   (0, 0)

(no "Exon" information available for 2OMW)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:461
 aligned with INLA_LISM4 | G2K3G6 from UniProtKB/Swiss-Prot  Length:800

    Alignment length:461
                                    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495 
           INLA_LISM4    36 ATITQDTPINQIFTDAALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTNLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGHNQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDGGSYAEPDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKA 496
               SCOP domains d2omwa2 A:36-416 Internalin A                                                                                                                                                                                                                                                                                                                                                                d2omwa1 A:417-496 Internalin A                                                   SCOP domains
               CATH domains 2omwA01 A:36-414 Ribonuclease Inhibitor                                                                                                                                                                                                                                                                                                                                                    2omwA02 A:415-496  [code=2.60.40.1220, no name defined]                            CATH domains
           Pfam domains (1) Internalin_N-2omwA12    ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA01 A:360-403                     -----------------------------------LRR_adjacent-2omwA13 A:439-496                             Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA02 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA03 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA04 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (4)
           Pfam domains (5) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA05 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (5)
           Pfam domains (6) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA06 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (6)
           Pfam domains (7) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA07 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (7)
           Pfam domains (8) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA08 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (8)
           Pfam domains (9) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA09 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (9)
          Pfam domains (10) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA10 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (10)
          Pfam domains (11) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA11 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (11)
         Sec.struct. author ......eehhhhh.hhhhhhhhhhhh.......eehhhhhh...eee..........hhhhh....eee........hhhhh......eee........hhhhh......eee........hhhhh......eeeeeeeee..hhhhh......eeeeee....hhhhh......eee........hhhhhhh....eee........hhhhhhh....eee........hhhhhhh....eee........hhhhh......eee........hhhhh......eee........hhhhhhh....eee........hhhhh......eee........hhhhhhh....eee........hhhhh......eee...eeee...ee...eeeee..............ee....eee..eeeee......eeeeeeeeeeee..eeeeeeeeeeeeee. Sec.struct. author
             SAPs(SNPs) (1) ---------------A------------------------------------------L-----------------------D-----------------------S--------------------------------------------N-----L-----------------------------------------------------------W--------------------------------------P----------------------------S-----------------------------------------------------------S----------------------------------E-------------------------------------A-------------------N-S-------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------R------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                    PROSITE -----------------------------------------LRR  PDB: A:77-98     LRR  PDB: A:99-120    LRR  PDB: A:121-142   LRR  PDB: A:143-164   LRR  PDB: A:165-186   LRR  PDB: A:188-207  LRR  PDB: A:208-229   LRR  PDB: A:230-251   LRR  PDB: A:252-273   LRR  PDB: A:274-295   LRR  PDB: A:296-317   LRR  PDB: A:318-339   LRR  PDB: A:340-361   LRR  PDB: A:362-383   LRR  PDB: A:384-405   ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2omw A  36 ATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLNFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFSNNKVSDVSSLANLTNINWLSAGHNQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDGGSYTEPDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKA 496
                                    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495 

Chain A from PDB  Type:PROTEIN  Length:461
 aligned with INLA_LISMO | P0DJM0 from UniProtKB/Swiss-Prot  Length:800

    Alignment length:461
                                    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495 
           INLA_LISMO    36 ATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGHNQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDGGSYTEPDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKA 496
               SCOP domains d2omwa2 A:36-416 Internalin A                                                                                                                                                                                                                                                                                                                                                                d2omwa1 A:417-496 Internalin A                                                   SCOP domains
               CATH domains 2omwA01 A:36-414 Ribonuclease Inhibitor                                                                                                                                                                                                                                                                                                                                                    2omwA02 A:415-496  [code=2.60.40.1220, no name defined]                            CATH domains
           Pfam domains (1) Internalin_N-2omwA12    ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA01 A:360-403                     -----------------------------------LRR_adjacent-2omwA13 A:439-496                             Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA02 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA03 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA04 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (4)
           Pfam domains (5) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA05 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (5)
           Pfam domains (6) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA06 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (6)
           Pfam domains (7) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA07 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (7)
           Pfam domains (8) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA08 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (8)
           Pfam domains (9) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA09 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (9)
          Pfam domains (10) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA10 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (10)
          Pfam domains (11) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_4-2omwA11 A:360-403                     --------------------------------------------------------------------------------------------- Pfam domains (11)
         Sec.struct. author ......eehhhhh.hhhhhhhhhhhh.......eehhhhhh...eee..........hhhhh....eee........hhhhh......eee........hhhhh......eee........hhhhh......eeeeeeeee..hhhhh......eeeeee....hhhhh......eee........hhhhhhh....eee........hhhhhhh....eee........hhhhhhh....eee........hhhhh......eee........hhhhh......eee........hhhhhhh....eee........hhhhh......eee........hhhhhhh....eee........hhhhh......eee...eeee...ee...eeeee..............ee....eee..eeeee......eeeeeeeeeeee..eeeeeeeeeeeeee. Sec.struct. author
             SAPs(SNPs) (1) ---------------A------------------------------------------L-----------------------D-----------------------S--------------------------------------------N-----L-----------------------------------------------------------W--------------------------------------P----------------------------S-----------------------------------------------------------S----------------------------------E-------------------------------------A-------------------N-S-------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------R------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                PROSITE (2) ---------------------------------------------------------------LRR  PDB: A:99-120    LRR  PDB: A:121-142   LRR  PDB: A:143-164   LRR  PDB: A:165-186   LRR  PDB: A:187-207  LRR  PDB: A:208-229   LRR  PDB: A:230-251   LRR  PDB: A:252-273   LRR  PDB: A:274-295   LRR  PDB: A:296-317   LRR  PDB: A:318-339   LRR  PDB: A:340-361   LRR  PDB: A:362-383   LRR  PDB: A:384-405   ------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2omw A  36 ATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLNFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFSNNKVSDVSSLANLTNINWLSAGHNQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDGGSYTEPDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKA 496
                                    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495 

Chain B from PDB  Type:PROTEIN  Length:105
 aligned with CADH1_MOUSE | P09803 from UniProtKB/Swiss-Prot  Length:884

    Alignment length:139
                                   128       138       148       158       168       178       188       198       208       218       228       238       248         
          CADH1_MOUSE   119 KSMGHHHHRHHHRDPASESNPELLMFPSVYPGLRRQKRDWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSNGEAVEDPMEIVITVTDQ 257
               SCOP domains ---------------------------------------d2omwb1 B:2-100 E-cadherin (epithelial)                                                            - SCOP domains
               CATH domains 2omw                                  B00 B:-3-101 Cadherins                                                                                CATH domains
               Pfam domains ------------------------------------------Cadherin-2omwB01 B:5-99                                                                        -- Pfam domains
         Sec.struct. author ....----------------------------------.ee....eee........eeeee.ee.hhhh...eeeeee..........eee.....eeee..........eeeeeeeee..........eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------CADHERIN_2  PDB: B:26-100 UniProt: 182-264                                   PROSITE (3)
                PROSITE (4) -------------------------------------------------------------------------------------------------------------------------------------CADHER PROSITE (4)
                PROSITE (1) ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2omw B  -3 GPLG----------------------------------SWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSNGNAVEDPMEIVITVTDA 101
                               |     -         -         -        |2        12        22        32        42        52        62        72        82        92         
                               0                                  1                                                                                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 3)

Asymmetric/Biological Unit

(-) CATH Domains  (3, 3)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (4, 14)

Asymmetric/Biological Unit
(-)
Clan: E-set (290)
(-)
Clan: LRR (77)
(-)
Family: LRR_4 (28)
2aLRR_4-2omwA01A:360-403
2bLRR_4-2omwA02A:360-403
2cLRR_4-2omwA03A:360-403
2dLRR_4-2omwA04A:360-403
2eLRR_4-2omwA05A:360-403
2fLRR_4-2omwA06A:360-403
2gLRR_4-2omwA07A:360-403
2hLRR_4-2omwA08A:360-403
2iLRR_4-2omwA09A:360-403
2jLRR_4-2omwA10A:360-403
2kLRR_4-2omwA11A:360-403

(-) Gene Ontology  (80, 82)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (INLA_LISM4 | G2K3G6)
cellular component
    GO:0005618    cell wall    The rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal, most prokaryotic cells and some protozoan parasites, maintaining their shape and protecting them from osmotic lysis. In plants it is made of cellulose and, often, lignin; in fungi it is composed largely of polysaccharides; in bacteria it is composed of peptidoglycan; in protozoan parasites such as Giardia species, it's made of carbohydrates and proteins.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain A   (INLA_LISMO | P0DJM0)
cellular component
    GO:0005618    cell wall    The rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal, most prokaryotic cells and some protozoan parasites, maintaining their shape and protecting them from osmotic lysis. In plants it is made of cellulose and, often, lignin; in fungi it is composed largely of polysaccharides; in bacteria it is composed of peptidoglycan; in protozoan parasites such as Giardia species, it's made of carbohydrates and proteins.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain B   (CADH1_MOUSE | P09803)
molecular function
    GO:0032794    GTPase activating protein binding    Interacting selectively and non-covalently with a GTPase activating protein.
    GO:0030506    ankyrin binding    Interacting selectively and non-covalently with ankyrin, a 200 kDa cytoskeletal protein that attaches other cytoskeletal proteins to integral membrane proteins.
    GO:0008013    beta-catenin binding    Interacting selectively and non-covalently with the beta subunit of the catenin complex.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0050839    cell adhesion molecule binding    Interacting selectively and non-covalently with a cell adhesion molecule.
    GO:0045295    gamma-catenin binding    Interacting selectively and non-covalently with the gamma subunit of the catenin complex.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
    GO:0019903    protein phosphatase binding    Interacting selectively and non-covalently with any protein phosphatase.
biological process
    GO:0034332    adherens junction organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an adherens junction. An adherens junction is a cell junction at which the cytoplasmic face of the plasma membrane is attached to actin filaments.
    GO:0070830    bicellular tight junction assembly    The aggregation, arrangement and bonding together of a set of components to form a tight junction, an occluding cell-cell junction that is composed of a branching network of sealing strands that completely encircles the apical end of each cell in an epithelial sheet.
    GO:0016339    calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules    The attachment of one cell to another cell via adhesion molecules that require the presence of calcium for the interaction.
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0071230    cellular response to amino acid stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups.
    GO:0071681    cellular response to indole-3-methanol    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an indole-3-methanol stimulus.
    GO:0071285    cellular response to lithium ion    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lithium (Li+) ion stimulus.
    GO:0090102    cochlea development    The progression of the cochlea over time from its formation to the mature structure. The cochlea is the snail-shaped portion of the inner ear that is responsible for the detection of sound.
    GO:0046697    decidualization    The cellular and vascular changes occurring in the endometrium of the pregnant uterus just after the onset of blastocyst implantation. This process involves the proliferation and differentiation of the fibroblast-like endometrial stromal cells into large, polyploid decidual cells that eventually form the maternal component of the placenta.
    GO:0007566    embryo implantation    Attachment of the blastocyst to the uterine lining.
    GO:0003382    epithelial cell morphogenesis    The change in form that occurs when an epithelial cell progresses from its initial formation to its mature state.
    GO:0090002    establishment of protein localization to plasma membrane    The directed movement of a protein to a specific location in the plasma membrane.
    GO:0007156    homophilic cell adhesion via plasma membrane adhesion molecules    The attachment of a plasma membrane adhesion molecule in one cell to an identical molecule in an adjacent cell.
    GO:0001701    in utero embryonic development    The process whose specific outcome is the progression of the embryo in the uterus over time, from formation of the zygote in the oviduct, to birth. An example of this process is found in Mus musculus.
    GO:0060576    intestinal epithelial cell development    The process whose specific outcome is the progression of a columnar/cuboidal epithelial cell of the intestine over time, from its formation to the mature structure.
    GO:0090090    negative regulation of canonical Wnt signaling pathway    Any process that decreases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
    GO:0022408    negative regulation of cell-cell adhesion    Any process that stops, prevents or reduces the rate or extent of cell adhesion to another cell.
    GO:0050680    negative regulation of epithelial cell proliferation    Any process that stops, prevents or reduces the rate or extent of epithelial cell proliferation.
    GO:0010955    negative regulation of protein processing    Any process that decreases the rate, frequency or extent of protein maturation by peptide bond cleavage.
    GO:0042993    positive regulation of transcription factor import into nucleus    Any process that activates or increases the frequency, rate or extent of the movement of a transcription factor from the cytoplasm to the nucleus.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0051260    protein homooligomerization    The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of identical component monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
    GO:0072659    protein localization to plasma membrane    A process in which a protein is transported to, or maintained in, a specific location in the plasma membrane.
    GO:0019538    protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general. Includes protein modification.
    GO:0060693    regulation of branching involved in salivary gland morphogenesis    Any process that modulates the rate, frequency, or extent of branching morphogenesis in the salivary gland epithelium.
    GO:0043281    regulation of cysteine-type endopeptidase activity involved in apoptotic process    Any process that modulates the activity of a cysteine-type endopeptidase involved in apoptosis.
    GO:0050776    regulation of immune response    Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
    GO:2001222    regulation of neuron migration    Any process that modulates the frequency, rate or extent of neuron migration.
    GO:0032880    regulation of protein localization    Any process that modulates the frequency, rate or extent of any process in which a protein is transported to, or maintained in, a specific location.
    GO:2000008    regulation of protein localization to cell surface    Any process that modulates the frequency, rate or extent of protein localization to the cell surface.
    GO:0033561    regulation of water loss via skin    A process that modulates the rate or extent of water loss from an organism via the skin.
    GO:0060662    salivary gland cavitation    The process in which the solid core of salivary epithelium gives rise to the hollow tube of the gland.
    GO:0007605    sensory perception of sound    The series of events required for an organism to receive an auditory stimulus, convert it to a molecular signal, and recognize and characterize the signal. Sonic stimuli are detected in the form of vibrations and are processed to form a sound.
    GO:0016337    single organismal cell-cell adhesion    The attachment of one cell to another cell via adhesion molecules, where both cells are part of the same organism.
    GO:0001829    trophectodermal cell differentiation    The process in which a relatively unspecialized cell acquires the specialized features of a trophectoderm cell.
    GO:0035847    uterine epithelium development    The progression of an epithelium of the uterus over time from its initial formation to the mature structure. An epithelium is a tissue that covers the internal or external surfaces of an anatomical structure.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0043220    Schmidt-Lanterman incisure    Regions within compact myelin in which the cytoplasmic faces of the enveloping myelin sheath are not tightly juxtaposed, and include cytoplasm from the cell responsible for making the myelin. Schmidt-Lanterman incisures occur in the compact myelin internode, while lateral loops are analogous structures found in the paranodal region adjacent to the nodes of Ranvier.
    GO:0015629    actin cytoskeleton    The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
    GO:0005912    adherens junction    A cell junction at which anchoring proteins (cadherins or integrins) extend through the plasma membrane and are attached to actin filaments.
    GO:0016235    aggresome    An inclusion body formed by dynein-dependent retrograde transport of an aggregated protein on microtubules.
    GO:0043296    apical junction complex    A functional unit located near the cell apex at the points of contact between epithelial cells, which in vertebrates is composed of the tight junction, the zonula adherens, and desmosomes and in some invertebrates, such as Drosophila, is composed of the subapical complex (SAC), the zonula adherens and the septate junction. Functions in the regulation of cell polarity, tissue integrity and intercellular adhesion and permeability.
    GO:0045177    apical part of cell    The region of a polarized cell that forms a tip or is distal to a base. For example, in a polarized epithelial cell, the apical region has an exposed surface and lies opposite to the basal lamina that separates the epithelium from other tissue.
    GO:0030424    axon    The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
    GO:0043679    axon terminus    Terminal inflated portion of the axon, containing the specialized apparatus necessary to release neurotransmitters. The axon terminus is considered to be the whole region of thickening and the terminal button is a specialized region of it.
    GO:0016323    basolateral plasma membrane    The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
    GO:0016342    catenin complex    Complex of peripheral cytoplasmic proteins (alpha-, beta- and gamma-catenin) that interact with the cytoplasmic region of uvomorulin/E-cadherin to connect it to the actin cytoskeleton.
    GO:0030054    cell junction    A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
    GO:0071944    cell periphery    The part of a cell encompassing the cell cortex, the plasma membrane, and any external encapsulating structures.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005913    cell-cell adherens junction    An adherens junction which connects a cell to another cell.
    GO:0005911    cell-cell junction    A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
    GO:0030864    cortical actin cytoskeleton    The portion of the actin cytoskeleton, comprising filamentous actin and associated proteins, that lies just beneath the plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0009898    cytoplasmic side of plasma membrane    The leaflet the plasma membrane that faces the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0005768    endosome    A vacuole to which materials ingested by endocytosis are delivered.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016600    flotillin complex    A protein complex that contains flotillin-1 and flotillin-2, and may contain associated proteins. Flotillins associate into membrane microdomains resembling caveolae.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0030027    lamellipodium    A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.
    GO:0043219    lateral loop    Non-compact myelin located adjacent to the nodes of Ranvier in a myelin segment. These non-compact regions include cytoplasm from the cell responsible for synthesizing the myelin. Lateral loops are found in the paranodal region adjacent to the nodes of Ranvier, while Schmidt-Lantermann clefts are analogous structures found within the compact myelin internode.
    GO:0016328    lateral plasma membrane    The portion of the plasma membrane at the lateral side of the cell. In epithelial cells, lateral plasma membranes are on the sides of cells which lie at the interface of adjacent cells.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0033268    node of Ranvier    An axon part that is a gap in the myelin where voltage-gated sodium channels cluster and saltatory conduction is executed.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0005802    trans-Golgi network    The network of interconnected tubular and cisternal structures located within the Golgi apparatus on the side distal to the endoplasmic reticulum, from which secretory vesicles emerge. The trans-Golgi network is important in the later stages of protein secretion where it is thought to play a key role in the sorting and targeting of secreted proteins to the correct destination.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:455 - Pro A:456   [ RasMol ]  
    Gly A:194 - Asn A:195   [ RasMol ]  
    Phe B:17 - Pro B:18   [ RasMol ]  
    Pro B:46 - Pro B:47   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2omw
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CADH1_MOUSE | P09803
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  INLA_LISM4 | G2K3G6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  INLA_LISMO | P0DJM0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CADH1_MOUSE | P09803
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  INLA_LISM4 | G2K3G6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  INLA_LISMO | P0DJM0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CADH1_MOUSE | P098031edh 1ff5 1i7w 1i7x 1q1p 1suh 2qvf 3ifq 3lne 3lnf 3lng 3lnh 3lni 3q2l 3q2n 3q2v 3qrb 4qd2
        INLA_LISM4 | G2K3G61o6s 1o6t 1o6v 2omt 2omu 2omv 2omx 2omy 2omz
        INLA_LISMO | P0DJM01o6s 1o6t 1o6v 2omt 2omu 2omv 2omx 2omy 2omz

(-) Related Entries Specified in the PDB File

1o6s