2HLE - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   STRUCTURAL AND BIOPHYSICAL CHARACTERIZATION OF THE EPHB4-EPHRINB2 PROTEIN PROTEIN INTERACTION AND RECEPTOR SPECIFICITY.

Authors :   J. E. Chrencik, A. Brooun, P. Kuhn, Accelerated Technologies Center To 3D Structure (Atcg3D)

Date :   06 Jul 06 (Deposition) - 22 Aug 06 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.05

Chains :   Asym./Biol. Unit : A,B

Keywords :   Protein-Protein Interaction, Receptor Tryosine Kinase, Bi-Directional Cell Signaling, Transferase-Transferase Receptor Complex, Structural Genomics, Psi-2, Protein Structure Initiative, Accelerated Technologies Center For Gene To 3D Structure, Atcg3D (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. E. Chrencik, A. Brooun, M. L. Kraus, M. I. Recht, A. R. Kolatkar, G. W. Han, J. M. Seifert, H. Widmer, M. Auer, P. Kuhn
Structural And Biophysical Characterization Of The Ephb4-Ephrinb2 Protein-Protein Interaction And Receptor Specificity.
J. Biol. Chem. V. 281 28185 2006
PubMed-ID: 16867992 | Reference-DOI: 10.1074/JBC.M605766200

Molecule 1 - EPHRIN TYPE-B RECEPTOR 4
	Cell Line	:	HI5
	Chains	:	A
	EC Number	:	2.7.10.1
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Common	:	FALL ARMYWORM
	Expression System Taxid	:	7108
	Expression System Vector	:	PFASTBAC1
	Expression System Vector Type	:	BACULOVIRUS
	Fragment	:	LIGAND BINDING DOMAIN
	Gene	:	EPHB4, HTK
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TYROSINE-PROTEIN KINASE RECEPTOR HTK, EPHB4

Molecule 2 - EPHRIN-B2
	Cell Line	:	HI5
	Chains	:	B
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Common	:	FALL ARMYWORM
	Expression System Taxid	:	7108
	Expression System Vector	:	PFASTBAC1
	Expression System Vector Type	:	BACULOVIRUS
	Fragment	:	EXTRACELLULAR DOMAIN
	Gene	:	EFNB2, EPLG5, HTKL, LERK5
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	EPH-RELATED RECEPTOR TYROSINE KINASE LIGAND 5, LERK-5, HTK LIGAND, HTK-L, EPHRINB2

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2HLE)

(no "Site" information available for 2HLE)

Asymmetric/Biological Unit

No.	Residues
1	A:61	-	A:184
2	A:97	-	A:107
3	B:65	-	B:104
4	B:92	-	B:156

Asymmetric/Biological Unit

No.	Residues
1	Phe A:35	-	Pro A:36
2	Thr A:127	-	Pro A:128
3	Asn A:133	-	Pro A:134
4	Gly A:167	-	Pro A:168
5	Asp B:90	-	Arg B:91

Asymmetric/Biological Unit (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_042181	P	67	L	EPHB4_HUMAN	Polymorphism	34653459	A	P	67	L
2	UniProt	VAR_042182	V	113	I	EPHB4_HUMAN	Polymorphism	55866373	A	V	113	I
3	UniProt	VAR_071163	K	162	R	EPHB4_HUMAN	Polymorphism	17854760	A	K	162	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EPH_LBD	PS51550	Eph receptor ligand-binding domain profile.	EPHB4_HUMAN	17-202	1	A:17-196
2	EPHRIN_RBD_2	PS51551	Ephrin receptor-binding (ephrin RBD) domain profile.	EFNB2_HUMAN	28-164	1	B:31-167
3	EPHRIN_RBD_1	PS01299	Ephrin receptor-binding (ephrin RBD) domain signature.	EFNB2_HUMAN	109-136	1	B:112-139
4	RECEPTOR_TYR_KIN_V_1	PS00790	Receptor tyrosine kinase class V signature 1.	EPHB4_HUMAN	178-198	1	A:178-196

Asymmetric/Biological Unit (7, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000245323	1a	ENSE00001931658	chr13:107187462-107187191	272	EFNB2_HUMAN	1-41	41	1	B:31-44	14
1.2	ENST00000245323	2	ENSE00001654984	chr13:107165160-107164877	284	EFNB2_HUMAN	41-136	96	1	B:44-139 (gaps)	96
1.3	ENST00000245323	3	ENSE00000995278	chr13:107148188-107148096	93	EFNB2_HUMAN	136-167	32	1	B:139-168	30
1.4	ENST00000245323	4	ENSE00000854052	chr13:107147342-107147229	114	EFNB2_HUMAN	167-205	39	0	-	-
1.5b	ENST00000245323	5b	ENSE00001923391	chr13:107145776-107142093	3684	EFNB2_HUMAN	205-333	129	0	-	-

2.1b	ENST00000358173	1b	ENSE00001868923	chr7:100425121-100424601	521	EPHB4_HUMAN	1-18	18	1	A:9-18	10
2.2b	ENST00000358173	2b	ENSE00000825052	chr7:100421895-100421825	71	EPHB4_HUMAN	18-41	24	1	A:18-41	24
2.3	ENST00000358173	3	ENSE00000825051	chr7:100421553-100421266	288	EPHB4_HUMAN	42-137	96	1	A:42-137	96
2.4	ENST00000358173	4	ENSE00000825050	chr7:100420289-100419893	397	EPHB4_HUMAN	138-270	133	1	A:138-196	59
2.5b	ENST00000358173	5b	ENSE00000825049	chr7:100417918-100417763	156	EPHB4_HUMAN	270-322	53	0	-	-
2.6	ENST00000358173	6	ENSE00000825048	chr7:100417511-100417179	333	EPHB4_HUMAN	322-433	112	0	-	-
2.7b	ENST00000358173	7b	ENSE00000710240	chr7:100416266-100416142	125	EPHB4_HUMAN	433-474	42	0	-	-
2.8c	ENST00000358173	8c	ENSE00001706820	chr7:100414979-100414814	166	EPHB4_HUMAN	475-530	56	0	-	-
2.9c	ENST00000358173	9c	ENSE00001665919	chr7:100411643-100411541	103	EPHB4_HUMAN	530-564	35	0	-	-
2.10	ENST00000358173	10	ENSE00001787983	chr7:100411338-100411274	65	EPHB4_HUMAN	564-586	23	0	-	-
2.11b	ENST00000358173	11b	ENSE00001754468	chr7:100410830-100410717	114	EPHB4_HUMAN	586-624	39	0	-	-
2.12	ENST00000358173	12	ENSE00001631272	chr7:100410616-100410369	248	EPHB4_HUMAN	624-706	83	0	-	-
2.13a	ENST00000358173	13a	ENSE00001753966	chr7:100405202-100404987	216	EPHB4_HUMAN	707-778	72	0	-	-
2.14a	ENST00000358173	14a	ENSE00001623534	chr7:100404191-100404042	150	EPHB4_HUMAN	779-828	50	0	-	-
2.15	ENST00000358173	15	ENSE00001783205	chr7:100403316-100403123	194	EPHB4_HUMAN	829-893	65	0	-	-
2.16	ENST00000358173	16	ENSE00001649970	chr7:100402943-100402788	156	EPHB4_HUMAN	893-945	53	0	-	-
2.17b	ENST00000358173	17b	ENSE00001639386	chr7:100401212-100400187	1026	EPHB4_HUMAN	945-987	43	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:188
 aligned with EPHB4_HUMAN | P54760 from UniProtKB/Swiss-Prot  Length:987

    Alignment length:188
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188        
          EPHB4_HUMAN     9 WASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKK 196
               SCOP domains --------d2hlea1 A:17-196 Ephrin type-B receptor 4                                                                                                                                            SCOP domains
               CATH domains 2hleA00 A:9-196 Galactose-binding domain-like                                                                                                                                                CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeee..........eee.......eeeeee.....eeeeeeee.........eeee...ee......eeeeeeeee.hhhhh.........eeeeeeeee.................eeeeeee.....eee...eee...eeeeeee......eeeeeeee...eeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------L---------------------------------------------I------------------------------------------------R---------------------------------- SAPs(SNPs)
                PROSITE (1) --------EPH_LBD  PDB: A:17-196 UniProt: 17-202                                                                                                                                               PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------RECEPTOR_TYR_KIN_V_ PROSITE (2)
           Transcript 2 (1) Exon 2.1b -----------------------Exon 2.3  PDB: A:42-137 UniProt: 42-137                                                         Exon 2.4  PDB: A:138-196 UniProt: 138-270 [INCOMPLETE]      Transcript 2 (1)
           Transcript 2 (2) ---------Exon 2.2b  PDB: A:18-41 ----------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2 (2)
                 2hle A   9 AGHHHHHHEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKK 196
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188

Chain B from PDB  Type:PROTEIN  Length:133
 aligned with EFNB2_HUMAN | P52799 from UniProtKB/Swiss-Prot  Length:333

    Alignment length:138
                                    37        47        57        67        77        87        97       107       117       127       137       147       157        
          EFNB2_HUMAN    28 IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG 165
               SCOP domains d2hleb_ B: Ephrin-b2 ectodomain                                                                                                            SCOP domains
               CATH domains 2hleB00 B:31-168 Cupredoxins -  blue copper  proteins                                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....ee.............eee......eeeeee........-....eeeeeehhhhhh.....----..eee......eeeeee................eeeeee.......................eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) EPHRIN_RBD_2  PDB: B:31-167 UniProt: 28-164                                                                                              - PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------EPHRIN_RBD_1  PDB: B:112-139----------------------------- PROSITE (3)
           Transcript 1 (1) Exon 1.1a     ----------------------------------------------------------------------------------------------Exon 1.3  PDB: B:139-168       Transcript 1 (1)
           Transcript 1 (2) -------------Exon 1.2  PDB: B:44-139 (gaps) UniProt: 41-136                                                  ----------------------------- Transcript 1 (2)
                 2hle B  31 IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTV-QYEYYKVYMVDKDQADRCTIK----PLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG 168
                                    40        50        60        70  | |   80        90    |  100       110       120       130       140       150       160        
                                                                     73 |                  95  100                                                                    
                                                                       75

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Cupredoxin-like (545)

Superfamily: Cupredoxins (543)

Family: Ephrin ectodomain (11)

Protein domain: Ephrin-b2 ectodomain (4)

Human (Homo sapiens) [TaxId: 9606] (2)

d2hleb_

Fold: Galactose-binding domain-like (314)

Superfamily: Galactose-binding domain-like (314)

Family: Ephrin receptor ligand binding domain (15)

Protein domain: Ephrin type-B receptor 4 (2)

Human (Homo sapiens) [TaxId: 9606] (2)

d2hlea1

A:17-196

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: Cupredoxins - blue copper proteins (420)

Human (Homo sapiens) (5)

2hleB00

B:31-168

Topology: Jelly Rolls (1293)

Homologous Superfamily: Galactose-binding domain-like (195)

Human (Homo sapiens) (39)

2hleA00

A:9-196

(no "Pfam Domain" information available for 2HLE)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (EPHB4_HUMAN | P54760)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0005003	ephrin receptor activity	Combining with an ephrin to initiate a change in cell activity.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0004713	protein tyrosine kinase activity	Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0004714	transmembrane receptor protein tyrosine kinase activity	Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
biological process
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0002042	cell migration involved in sprouting angiogenesis	The orderly movement of endothelial cells into the extracellular matrix in order to form new blood vessels involved in sprouting angiogenesis.
	GO:0048013	ephrin receptor signaling pathway	The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
	GO:0003007	heart morphogenesis	The developmental process in which the heart is generated and organized. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0018108	peptidyl-tyrosine phosphorylation	The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0046777	protein autophosphorylation	The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B (EFNB2_HUMAN | P52799)

molecular function
	GO:0046875	ephrin receptor binding	Interacting selectively and non-covalently with an ephrin receptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0001618	virus receptor activity	Combining with a virus component and mediating entry of the virus into the cell.
biological process
	GO:0031295	T cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
	GO:0009653	anatomical structure morphogenesis	The process in which anatomical structures are generated and organized. Morphogenesis pertains to the creation of form.
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0009887	animal organ morphogenesis	Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
	GO:0007411	axon guidance	The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
	GO:0048514	blood vessel morphogenesis	The process in which the anatomical structures of blood vessels are generated and organized. The blood vessel is the vasculature carrying blood.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0002042	cell migration involved in sprouting angiogenesis	The orderly movement of endothelial cells into the extracellular matrix in order to form new blood vessels involved in sprouting angiogenesis.
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0048013	ephrin receptor signaling pathway	The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
	GO:0001945	lymph vessel development	The process whose specific outcome is the progression of a lymph vessel over time, from its formation to the mature structure.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0010839	negative regulation of keratinocyte proliferation	Any process that decreases the rate, frequency or extent of keratinocyte proliferation. Keratinocyte proliferation is the multiplication or reproduction of keratinocytes, resulting in the expansion of a cell population.
	GO:0072178	nephric duct morphogenesis	The process in which the anatomical structures of the nephric duct are generated and organized. A nephric duct is a tube that drains a primitive kidney.
	GO:0007399	nervous system development	The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
	GO:2000727	positive regulation of cardiac muscle cell differentiation	Any process that activates or increases the frequency, rate or extent of cardiac muscle cell differentiation.
	GO:0050920	regulation of chemotaxis	Any process that modulates the frequency, rate or extent of the directed movement of a motile cell or organism in response to a specific chemical concentration gradient.
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2hle)

	Sites
(no "Sites" information available for 2hle)

	Cis Peptide Bonds
		Asn A:133 - Pro A:134	[ RasMol ]
		Asp B:90 - Arg B:91	[ RasMol ]
		Gly A:167 - Pro A:168	[ RasMol ]
		Phe A:35 - Pro A:36	[ RasMol ]
		Thr A:127 - Pro A:128	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2hle
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	EFNB2_HUMAN \| P52799
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	EPHB4_HUMAN \| P54760
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.10.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	EFNB2_HUMAN \| P52799
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	EPHB4_HUMAN \| P54760
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1kgy	RELATED ID: ATCG3D_14 RELATED DB: TARGETDB
1nuk
2bba

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (4, 4)

Cis Peptide Bonds (5, 5)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

PROSITE Motifs (4, 4)

Exons (7, 7)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (2, 2)

Pfam Domains (0, 0)

Gene Ontology (46, 71)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File