Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  NIPAH VIRUS ATTACHMENT GLYCOPROTEIN IN COMPLEX WITH HUMAN CELL SURFACE RECEPTOR EPHRINB2
 
Authors :  T. A. Bowden, A. R. Aricescu, R. J. Gilbert, J. M. Grimes, E. Y. Jones, D. I. Stuart
Date :  25 Apr 08  (Deposition) - 20 May 08  (Release) - 28 Apr 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Developmental Protein, Henipavirus, Neurogenesis, Glycoprotein, Paramyxovirus, Envelope Protein, Cell Surface Receptor, Hendra, Virion, Ephrin, Complex, Membrane, Hydrolase, B2, Efn, Niv, Eph, Hev, Hev-G, Nipah, Virus, Niv-G, Phosphoprotein, Differentiation, Viral Attachment, Signal-Anchor, Hemagglutinin, Transmembrane (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. A. Bowden, A. R. Aricescu, R. J. Gilbert, J. M. Grimes, E. Y. Jones, D. I. Stuart
Structural Basis Of Nipah And Hendra Virus Attachment To Their Cell-Surface Receptor Ephrin-B2
Nat. Struct. Mol. Biol. V. 15 567 2008
PubMed-ID: 18488039  |  Reference-DOI: 10.1038/NSMB.1435

(-) Compounds

Molecule 1 - HEMAGGLUTININ-NEURAMINIDASE
    Chains: A
    EC Number: 3.2.1.18
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Cell Line: HUMAN EMBRYONIC KIDNEY 293T
    Expression System Plasmid: PHLSEC
    Expression System Strain: CRL-1573
    Expression System Taxid: 9606
    Fragment: B-PROPELLER, EPHRIN BINDING DOMAIN, RESIDUES 188-602
    Organism Scientific: NIPAH VIRUS
    Organism Taxid: 121791
    Other Details: N-ACETYLGLUCOSAMINE LINKAGES OBSERVED IN STRUCTURE: ASN417 ASN529 ASN481
    Other Details - Source: SYNTHETICALLY OPTIMIZED CDNA (GENEART)
    Synonym: NIV-G
 
Molecule 2 - EPHRIN-B2
    Chains: B
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Cell Line: HUMAN EMBRYONIC KIDNEY 293T
    Expression System Plasmid: PHLSEC
    Expression System Strain: CRL-1573
    Expression System Taxid: 9606
    Fragment: RECEPTOR-BINDING DOMAIN, RESIDUES 28-165
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Other Details: N-ACETYLGLUCOSAMINE LINKAGE OBSERVED IN STRUCTURE: ASN39
    Synonym: EFNB2, EPH-RELATED RECEPTOR TYROSINE KINASE LIGAND 5, LERK-5, HTK LIGAND, HTK-L

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric/Biological Unit (2, 5)
No.NameCountTypeFull Name
1IPA1Ligand/IonISOPROPYL ALCOHOL
2NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:454 , THR A:462 , ILE A:464 , SER A:486 , ASN A:509 , HOH A:2495 , HOH A:2496BINDING SITE FOR RESIDUE IPA A1604
2AC2SOFTWARETHR A:361 , LYS A:415 , ASN A:417 , SER A:419 , LYS A:569 , HOH A:2232 , HOH A:2311BINDING SITE FOR RESIDUE NAG A1605
3AC3SOFTWAREASN A:529 , HOH A:2386 , HOH A:2387 , HOH A:2497BINDING SITE FOR RESIDUE NAG A1606
4AC4SOFTWAREASN A:478 , TRP A:479 , ARG A:480 , ASN A:481 , HOH A:2366 , HOH A:2368 , HOH A:2499BINDING SITE FOR RESIDUE NAG A1607
5AC5SOFTWAREILE A:517 , ASN B:39 , SER B:40 , SER B:41 , LYS B:67 , VAL B:73 , GLY B:74 , GLU B:77 , HOH B:2046 , HOH B:2205BINDING SITE FOR RESIDUE NAG B1171

(-) SS Bonds  (9, 9)

Asymmetric/Biological Unit
No.Residues
1A:189 -A:601
2A:216 -A:240
3A:282 -A:295
4A:382 -A:395
5A:387 -A:499
6A:493 -A:503
7A:565 -A:574
8B:65 -B:104
9B:92 -B:156

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Asn A:473 -Pro A:474

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (8, 8)

Asymmetric/Biological Unit (8, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_GLYCP_NIPAV_004 *R248KGLYCP_NIPAV  ---  ---AR248K
2UniProtVAR_GLYCP_NIPAV_005 *T272AGLYCP_NIPAV  ---  ---AT272A
3UniProtVAR_GLYCP_NIPAV_006 *G327DGLYCP_NIPAV  ---  ---AG327D
4UniProtVAR_GLYCP_NIPAV_007 *I408VGLYCP_NIPAV  ---  ---AI408V
5UniProtVAR_GLYCP_NIPAV_008 *V426IGLYCP_NIPAV  ---  ---AV426I
6UniProtVAR_GLYCP_NIPAV_009 *L470QGLYCP_NIPAV  ---  ---AL470Q
7UniProtVAR_GLYCP_NIPAV_010 *N478SGLYCP_NIPAV  ---  ---AN478S
8UniProtVAR_GLYCP_NIPAV_011 *N481DGLYCP_NIPAV  ---  ---AN481D
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 2)

Asymmetric/Biological Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EPHRIN_RBD_2PS51551 Ephrin receptor-binding (ephrin RBD) domain profile.EFNB2_HUMAN28-164  1B:31-167
2EPHRIN_RBD_1PS01299 Ephrin receptor-binding (ephrin RBD) domain signature.EFNB2_HUMAN109-136  1B:112-139

(-) Exons   (4, 4)

Asymmetric/Biological Unit (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002453231aENSE00001931658chr13:107187462-107187191272EFNB2_HUMAN1-41411B:31-4414
1.2ENST000002453232ENSE00001654984chr13:107165160-107164877284EFNB2_HUMAN41-136961B:44-139 (gaps)96
1.3ENST000002453233ENSE00000995278chr13:107148188-10714809693EFNB2_HUMAN136-167321B:139-17032
1.4ENST000002453234ENSE00000854052chr13:107147342-107147229114EFNB2_HUMAN167-205391B:170-1701
1.5bENST000002453235bENSE00001923391chr13:107145776-1071420933684EFNB2_HUMAN205-3331290--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:413
 aligned with GLYCP_NIPAV | Q9IH62 from UniProtKB/Swiss-Prot  Length:602

    Alignment length:416
                                                                                                                                                                                                                                                                                                                                                                                                                                                        602 
                                   197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597    | 
          GLYCP_NIPAV   188 ICLQKTSNQILKPKLISYTLPVVGQSGTCITDPLLAMDEGYFAYSHLERIGSCSRGVSKQRIIGVGEVLDRGDEVPSLFMTNVWTPPNPNTVYHCSAVYNNEFYYVLCAVSTVGDPILNSTYWSGSLMMTRLAVKPKSNGGGYNQHQLALRSIEKGRYDKVMPYGPSGIKQGDTLYFPAVGFLVRTEFKYNDSNCPITKCQYSKPENCRLSMGIRPNSHYILRSGLLKYNLSDGENPKVVFIEISDQRLSIGSPSKIYDSLGQPVFYQASFSWDTMIKFGDVLTVNPLVVNWRNNTVISRPGQSQCPRFNTCPEICWEGVYNDAFLIDRINWISAGVFLDSNQTAENPVFTVFKDNEILYRAQLASEDTNAQKTITNCFLLKNKIWCISLVEIYDTGDNVIRPKLFAVKIPEQCT-   -
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains HN-2vsmA01 A:188-601                                                                                                                                                                                                                                                                                                                                                                                                          -- Pfam domains
         Sec.struct. author .............eee....---....eeeeeeeeeee..eeeeeeeeee......eeeeeeeeeeeeee.....eeeeeeeee.......eeeeeeeee..eeeeeeee................eeeeeee......hhhhheeeee...ee.....eeee.....eee..eeeeeeeeeee.hhh..hhhhh..........hhhhhh........eeeeeeeeeee.hhh....eeeee...........eeeeee..eeeeee.........eeeeeee....eeee...............................eeeee....eeeeeee........eeeeeee..eeeeeee......eeeeeeeeeeee..eeeeeeeeeee.....ee..eeeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------K-----------------------A------------------------------------------------------D--------------------------------------------------------------------------------V-----------------I-------------------------------------------Q-------S--D-------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2vsm A 188 ICLQKTSNQILKPKLISYTL---GQSGTCITDPLLAMDEGYFAYSHLERIGSCSRGVSKQRIIGVGEVLDRGDEVPSLFMTNVWTPPNPNTVYHCSAVYNNEFYYVLCAVSTVGDPILNSTYWSGSLMMTRLAVKPKSNGGGYNQHQLALRSIEKGRYDKVMPYGPSGIKQGDTLYFPAVGFLVRTEFKYNDSNCPITKCQYSKPENCRLSMGIRPNSHYILRSGLLKYNLSDGENPKVVFIEISDQRLSIGSPSKIYDSLGQPVFYQASFSWDTMIKFGDVLTVNPLVVNWRNNTVISRPGQSQCPRFNTCPEICWEGVYNDAFLIDRINWISAGVFLDSNQTAENPVFTVFKDNEILYRAQLASEDTNAQKTITNCFLLKNKIWCISLVEIYDTGDNVIRPKLFAVKIPEQCTH 603
                                   197       207   |   217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597      
                                             207 211                                                                                                                                                                                                                                                                                                                                                                                                        

Chain B from PDB  Type:PROTEIN  Length:137
 aligned with EFNB2_HUMAN | P52799 from UniProtKB/Swiss-Prot  Length:333

    Alignment length:140
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167
          EFNB2_HUMAN    28 IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQD 167
               SCOP domains d2vsmb_ B: automated matches                                                                                                                 SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains Ephrin-2vsmB01 B:31-168                                                                                                                   -- Pfam domains
         Sec.struct. author .....ee.............eee......eeeeee....---......eeeeeehhhhhhhh.........eee......eeeeee................eeeeee.....hhhhh....hhhhhhh..eeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) EPHRIN_RBD_2  PDB: B:31-167 UniProt: 28-164                                                                                              --- PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------EPHRIN_RBD_1  PDB: B:112-139------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1a     ----------------------------------------------------------------------------------------------Exon 1.3  PDB: B:139-170         Transcript 1 (1)
           Transcript 1 (2) -------------Exon 1.2  PDB: B:44-139 (gaps) UniProt: 41-136                                                  ------------------------------1 Transcript 1 (2)
                 2vsm B  31 IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVD---VGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGHH 170
                                    40        50        60        |-  |     80        90       100       110       120       130       140       150       160       170
                                                                 69  73                                                                                                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2VSM)

(-) Pfam Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Family: HN (6)
2aHN-2vsmA01A:188-601

(-) Gene Ontology  (40, 44)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (GLYCP_NIPAV | Q9IH62)
molecular function
    GO:0004308    exo-alpha-sialidase activity    Catalysis of the hydrolysis of alpha-(2->3)-, alpha-(2->6)-, alpha-(2->8)-glycosidic linkages of terminal sialic residues in oligosaccharides, glycoproteins, glycolipids, colominic acid and synthetic substrates.
    GO:0046789    host cell surface receptor binding    Interacting selectively and non-covalently with a receptor on the host cell surface.
biological process
    GO:0075512    clathrin-dependent endocytosis of virus by host cell    Any clathrin-mediated endocytosis that is involved in the uptake of a virus into a host cell. Begins by invagination of a specific region of the host cell plasma membrane around the bound virus to form a clathrin-coated pit, which then pinches off to form a clathrin-coated endocytic vesicle containing the virus.
    GO:0075509    endocytosis involved in viral entry into host cell    Any endocytosis that is involved in the uptake of a virus into a host cell.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0019058    viral life cycle    A set of processes which all viruses follow to ensure survival; includes attachment and entry of the virus particle, decoding of genome information, translation of viral mRNA by host ribosomes, genome replication, and assembly and release of viral particles containing the genome.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
    GO:0019062    virion attachment to host cell    The process by which a virion protein binds to molecules on the host cellular surface or host cell surface projection.
cellular component
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0020002    host cell plasma membrane    The plasma membrane surrounding a host cell.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0019031    viral envelope    The lipid bilayer of a virion that surrounds the protein capsid. May also contain glycoproteins.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.
    GO:0055036    virion membrane    The lipid bilayer surrounding a virion.

Chain B   (EFNB2_HUMAN | P52799)
molecular function
    GO:0046875    ephrin receptor binding    Interacting selectively and non-covalently with an ephrin receptor.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0001618    virus receptor activity    Combining with a virus component and mediating entry of the virus into the cell.
biological process
    GO:0031295    T cell costimulation    The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
    GO:0009653    anatomical structure morphogenesis    The process in which anatomical structures are generated and organized. Morphogenesis pertains to the creation of form.
    GO:0001525    angiogenesis    Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
    GO:0009887    animal organ morphogenesis    Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
    GO:0007411    axon guidance    The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
    GO:0048514    blood vessel morphogenesis    The process in which the anatomical structures of blood vessels are generated and organized. The blood vessel is the vasculature carrying blood.
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0030154    cell differentiation    The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
    GO:0002042    cell migration involved in sprouting angiogenesis    The orderly movement of endothelial cells into the extracellular matrix in order to form new blood vessels involved in sprouting angiogenesis.
    GO:0007267    cell-cell signaling    Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
    GO:0048013    ephrin receptor signaling pathway    The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
    GO:0001945    lymph vessel development    The process whose specific outcome is the progression of a lymph vessel over time, from its formation to the mature structure.
    GO:0007275    multicellular organism development    The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
    GO:0010839    negative regulation of keratinocyte proliferation    Any process that decreases the rate, frequency or extent of keratinocyte proliferation. Keratinocyte proliferation is the multiplication or reproduction of keratinocytes, resulting in the expansion of a cell population.
    GO:0072178    nephric duct morphogenesis    The process in which the anatomical structures of the nephric duct are generated and organized. A nephric duct is a tube that drains a primitive kidney.
    GO:0007399    nervous system development    The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
    GO:2000727    positive regulation of cardiac muscle cell differentiation    Any process that activates or increases the frequency, rate or extent of cardiac muscle cell differentiation.
    GO:0050920    regulation of chemotaxis    Any process that modulates the frequency, rate or extent of the directed movement of a motile cell or organism in response to a specific chemical concentration gradient.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    IPA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:473 - Pro A:474   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2vsm
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  EFNB2_HUMAN | P52799
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  GLYCP_NIPAV | Q9IH62
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.18
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  EFNB2_HUMAN | P52799
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  GLYCP_NIPAV | Q9IH62
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        EFNB2_HUMAN | P52799: 2hle 2i85 2vsk 2wo2 3gxu 4uf7
        GLYCP_NIPAV | Q9IH62: 2vwd 3d11 3d12

(-) Related Entries Specified in the PDB File

2vsk HENDRA VIRUS ATTACHMENT GLYCOPROTEIN IN COMPLEX WITH HUMAN CELL SURFACE RECEPTOR EPHRINB2