2VSK - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   HENDRA VIRUS ATTACHMENT GLYCOPROTEIN IN COMPLEX WITH HUMAN CELL SURFACE RECEPTOR EPHRINB2

Authors :   T. A. Bowden, A. R. Aricescu, R. J. Gilbert, J. M. Grimes, E. Y. Jones, D. I. Stuart

Date :   24 Apr 08 (Deposition) - 20 May 08 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.30

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Developmental Protein, Henipavirus, Neurogenesis, Glycoprotein, Paramyxovirus, Envelope Protein, Cell Surface Receptor, Hendra, Virion, Ephrin, Complex, Membrane, Hydrolase, B2, Efn, Niv, Eph, Hev, Hev-G, Nipah, Virus, Niv-G, Phosphoprotein, Differentiation, Viral Attachment, Signal-Anchor, Hemagglutinin, Transmembrane (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. A. Bowden, A. R. Aricescu, R. J. Gilbert, J. M. Grimes, E. Y. Jones, D. I. Stuart
Structural Basis Of Nipah And Hendra Virus Attachment To Their Cell-Surface Receptor Ephrin-B2
Nat. Struct. Mol. Biol. V. 15 567 2008
PubMed-ID: 18488039 | Reference-DOI: 10.1038/NSMB.1435

Molecule 1 - HEMAGGLUTININ-NEURAMINIDASE
	Chains	:	A, C
	EC Number	:	3.2.1.18
	Engineered	:	YES
	Expression System	:	HOMO SAPIENS
	Expression System Cell Line	:	HUMAN EMBRYONIC KIDNEY 293T
	Expression System Plasmid	:	PHLSEC
	Expression System Strain	:	CRL-1573
	Expression System Taxid	:	9606
	Fragment	:	B-PROPELLER, EPHRIN BINDING DOMAIN, RESIDUES 188-603
	Organism Scientific	:	HENDRA VIRUS
	Organism Taxid	:	63330
	Other Details	:	SYNTHETICALLY OPTIMIZED CDNA (GENEART)
	Synonym	:	HEV-G

Molecule 2 - EPHRIN-B2
	Chains	:	B, D
	Engineered	:	YES
	Expression System	:	HOMO SAPIENS
	Expression System Cell Line	:	HUMAN EMBRYONIC KIDNEY 293T
	Expression System Plasmid	:	PHLSEC
	Expression System Strain	:	CRL-1573
	Expression System Taxid	:	9606
	Fragment	:	RECEPTOR-BINDING DOMAIN, RESIDUES 28-165
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	EFNB2, EPH-RELATED RECEPTOR TYROSINE KINASE LIGAND 5, LERK-5, HTK LIGAND, HTK-L

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2VSK)

(no "Site" information available for 2VSK)

Asymmetric Unit

No.	Residues
1	A:189	-	A:601
2	A:216	-	A:240
3	A:282	-	A:295
4	A:382	-	A:395
5	A:387	-	A:499
6	A:493	-	A:503
7	A:565	-	A:574
8	B:65	-	B:104
9	B:92	-	B:156
10	C:189	-	C:601
11	C:216	-	C:240
12	C:282	-	C:295
13	C:382	-	C:395
14	C:387	-	C:499
15	C:493	-	C:503
16	C:565	-	C:574
17	D:65	-	D:104
18	D:92	-	D:156

Asymmetric Unit

No.	Residues
1	Asp A:473	-	Pro A:474
2	Asp C:473	-	Pro C:474

(no "SAP(SNP)/Variant" information available for 2VSK)

Asymmetric Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EPHRIN_RBD_2	PS51551	Ephrin receptor-binding (ephrin RBD) domain profile.	EFNB2_HUMAN	28-164	2	B:31-167 D:31-167
2	EPHRIN_RBD_1	PS01299	Ephrin receptor-binding (ephrin RBD) domain signature.	EFNB2_HUMAN	109-136	2	B:112-139 D:112-139

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EPHRIN_RBD_2	PS51551	Ephrin receptor-binding (ephrin RBD) domain profile.	EFNB2_HUMAN	28-164	1	B:31-167 -
2	EPHRIN_RBD_1	PS01299	Ephrin receptor-binding (ephrin RBD) domain signature.	EFNB2_HUMAN	109-136	1	B:112-139 -

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EPHRIN_RBD_2	PS51551	Ephrin receptor-binding (ephrin RBD) domain profile.	EFNB2_HUMAN	28-164	1	- D:31-167
2	EPHRIN_RBD_1	PS01299	Ephrin receptor-binding (ephrin RBD) domain signature.	EFNB2_HUMAN	109-136	1	- D:112-139

Asymmetric Unit (3, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000245323	1a	ENSE00001931658	chr13:107187462-107187191	272	EFNB2_HUMAN	1-41	41	2	B:31-44 D:31-44	14 14
1.2	ENST00000245323	2	ENSE00001654984	chr13:107165160-107164877	284	EFNB2_HUMAN	41-136	96	2	B:44-139 (gaps) D:44-139 (gaps)	96 96
1.3	ENST00000245323	3	ENSE00000995278	chr13:107148188-107148096	93	EFNB2_HUMAN	136-167	32	2	B:139-168 D:139-168	30 30
1.4	ENST00000245323	4	ENSE00000854052	chr13:107147342-107147229	114	EFNB2_HUMAN	167-205	39	0	-	-
1.5b	ENST00000245323	5b	ENSE00001923391	chr13:107145776-107142093	3684	EFNB2_HUMAN	205-333	129	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:400
 aligned with GLYCP_HENDH | O89343 from UniProtKB/Swiss-Prot  Length:604

    Alignment length:416
                                   197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597      
          GLYCP_HENDH   188 ICLQKTTSTILKPRLISYTLPINTREGVCITDPLLAVDNGFFAYSHLEKIGSCTRGIAKQRIIGVGEVLDRGDKVPSMFMTNVWTPPNPSTIHHCSSTYHEDFYYTLCAVSHVGDPILNSTSWTESLSLIRLAVRPKSDSGDYNQKYIAITKVERGKYDKVMPYGPSGIKQGDTLYFPAVGFLPRTEFQYNDSNCPIIHCKYSKAENCRLSMGVNSKSHYILRSGLLKYNLSLGGDIILQFIEIADNRLTIGSPSKIYNSLGQPVFYQASYSWDTMIKLGDVDTVDPLRVQWRNNSVISRPGQSQCPRFNVCPEVCWEGTYNDAFLIDRLNWVSAGVYLNSNQTAENPVFAVFKDNEILYQVPLAEDDTNAQKTITDCFLLENVIWCISLVEIYDTGDSVIRPKLFAVKIPAQCSE 603
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............ee..--------..eeeeeeeeeee..eeeeeeeeee......eeeeeeeeeeeeee.....eeeeeeeee.......eeeeeeeee..eeeeeeee....hhhhhhhhh...eeeeeee...-----...eeee....ee.....eeee.....eee..eeeeeeeeeee.hhh..hhhhh..........hhhhhh........eeeeeeeeeee...---..eeeee...........eeeeee..eeeeee.........eeeeeee....eeee................................eeee....eeeeeee........eeeeeee..eeeeeee......ee....eeeeee..eeeeee...ee...........ee......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2vsk A 188 ICLQKTTSTILKPRLIS--------EGVCITDPLLAVDNGFFAYSHLEKIGSCTRGIAKQRIIGVGEVLDRGDKVPSMFMTNVWTPPNPSTIHHCSSTYHEDFYYTLCAVSHVGDPILNSTSWTESLSLIRLAVRP-----DYNQKYIAITKVERGKYDKVMPYGPSGIKQGDTLYFPAVGFLPRTEFQYNDSNCPIIHCKYSKAENCRLSMGVNSKSHYILRSGLLKYNLSL---IILQFIEIADNRLTIGSPSKIYNSLGQPVFYQASYSWDTMIKLGDVDTVDPLRVQWRNNSVISRPGQSQCPRFNVCPEVCWEGTYNDAFLIDRLNWVSAGVYLNSNQTAENPVFAVFKDNEILYQVPLAEDDTNAQKTITDCFLLENVIWCISLVEIYDTGDSVIRPKLFAVKIPAQCSE 603
                                   197      |  -     | 217       227       237       247       257       267       277       287       297       307       317     |   - |     337       347       357       367       377       387       397       407       417  |   |427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597      
                                          204      213                                                                                                           323   329                                                                                        420 424

Chain B from PDB  Type:PROTEIN  Length:131
 aligned with EFNB2_HUMAN | P52799 from UniProtKB/Swiss-Prot  Length:333

    Alignment length:138
                                    37        47        57        67        77        87        97       107       117       127       137       147       157        
          EFNB2_HUMAN    28 IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG 165
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....ee.............eee......eeeeee...-------...eeeeeehhhhhhhh.........eee......eeeeee.................eeeee.......................eeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) EPHRIN_RBD_2  PDB: B:31-167 UniProt: 28-164                                                                                              - PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------EPHRIN_RBD_1  PDB: B:112-139----------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1a     ----------------------------------------------------------------------------------------------Exon 1.3  PDB: B:139-168       Transcript 1 (1)
           Transcript 1 (2) -------------Exon 1.2  PDB: B:44-139 (gaps) UniProt: 41-136                                                  ----------------------------- Transcript 1 (2)
                 2vsk B  31 IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKV-------YEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG 168
                                    40        50        60       | -     |  80        90       100       110       120       130       140       150       160        
                                                                68      76

Chain C from PDB  Type:PROTEIN  Length:399
 aligned with GLYCP_HENDH | O89343 from UniProtKB/Swiss-Prot  Length:604

    Alignment length:415
                                   197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597     
          GLYCP_HENDH   188 ICLQKTTSTILKPRLISYTLPINTREGVCITDPLLAVDNGFFAYSHLEKIGSCTRGIAKQRIIGVGEVLDRGDKVPSMFMTNVWTPPNPSTIHHCSSTYHEDFYYTLCAVSHVGDPILNSTSWTESLSLIRLAVRPKSDSGDYNQKYIAITKVERGKYDKVMPYGPSGIKQGDTLYFPAVGFLPRTEFQYNDSNCPIIHCKYSKAENCRLSMGVNSKSHYILRSGLLKYNLSLGGDIILQFIEIADNRLTIGSPSKIYNSLGQPVFYQASYSWDTMIKLGDVDTVDPLRVQWRNNSVISRPGQSQCPRFNVCPEVCWEGTYNDAFLIDRLNWVSAGVYLNSNQTAENPVFAVFKDNEILYQVPLAEDDTNAQKTITDCFLLENVIWCISLVEIYDTGDSVIRPKLFAVKIPAQCS 602
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) HN-2vskC01 C:188-        601                                                                                                                                                                                                                                                                                                                                                                                                  - Pfam domains (1)
           Pfam domains (2) HN-2vskC02 C:188-        601                                                                                                                                                                                                                                                                                                                                                                                                  - Pfam domains (2)
         Sec.struct. author .............ee..--------..eeeeeeeeeee..eeeeeeeeee......eeeeeeeeeeee.........eeeeeee.......eeeeeeeee..eeeeeeee....hhhhh.......eeeeeee...-----...eeee....ee.....eeee.....ee...eeeeeeeeeee.hhh..hhhhh..........hhhhhh........eeeeeeeeeee...---..eeeee...........eeeeee..eeeeee.........eeeeeee....ee..................................eeee....eeeeeee........eeeeeee..eeeeeee......ee....eeeeee..eeeeee..eee.......ee..ee........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2vsk C 188 ICLQKTTSTILKPRLIS--------EGVCITDPLLAVDNGFFAYSHLEKIGSCTRGIAKQRIIGVGEVLDRGDKVPSMFMTNVWTPPNPSTIHHCSSTYHEDFYYTLCAVSHVGDPILNSTSWTESLSLIRLAVRP-----DYNQKYIAITKVERGKYDKVMPYGPSGIKQGDTLYFPAVGFLPRTEFQYNDSNCPIIHCKYSKAENCRLSMGVNSKSHYILRSGLLKYNLSL---IILQFIEIADNRLTIGSPSKIYNSLGQPVFYQASYSWDTMIKLGDVDTVDPLRVQWRNNSVISRPGQSQCPRFNVCPEVCWEGTYNDAFLIDRLNWVSAGVYLNSNQTAENPVFAVFKDNEILYQVPLAEDDTNAQKTITDCFLLENVIWCISLVEIYDTGDSVIRPKLFAVKIPAQCS 602
                                   197      |  -     | 217       227       237       247       257       267       277       287       297       307       317     |   - |     337       347       357       367       377       387       397       407       417  |   |427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597     
                                          204      213                                                                                                           323   329                                                                                        420 424

Chain D from PDB  Type:PROTEIN  Length:131
 aligned with EFNB2_HUMAN | P52799 from UniProtKB/Swiss-Prot  Length:333

    Alignment length:138
                                    37        47        57        67        77        87        97       107       117       127       137       147       157        
          EFNB2_HUMAN    28 IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG 165
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) Ephrin-2vskD01 D:31-168                                                                                                                    Pfam domains (1)
           Pfam domains (2) Ephrin-2vskD02 D:31-168                                                                                                                    Pfam domains (2)
         Sec.struct. author .....ee.............eee......eeeeee...-------...eeeeeehhhhhhhh.........eee......eeeeee.................eeeee.......................eeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) EPHRIN_RBD_2  PDB: D:31-167 UniProt: 28-164                                                                                              - PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------EPHRIN_RBD_1  PDB: D:112-139----------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1a     ----------------------------------------------------------------------------------------------Exon 1.3  PDB: D:139-168       Transcript 1 (1)
           Transcript 1 (2) -------------Exon 1.2  PDB: D:44-139 (gaps) UniProt: 41-136                                                  ----------------------------- Transcript 1 (2)
                 2vsk D  31 IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKV-------YEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG 168
                                    40        50        60       | -     |  80        90       100       110       120       130       140       150       160        
                                                                68      76

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2VSK)

(no "CATH Domain" information available for 2VSK)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: CU_oxidase (192)

Family: Ephrin (10)

Homo sapiens (Human) (7)

1a	Ephrin-2vskD01	D:31-168
1b	Ephrin-2vskD02	D:31-168

Clan: Sialidase (56)

Family: HN (6)

Hendra virus (isolate Horse/Autralia/Hendra/1994) (1)

2a	HN-2vskC01	C:188-601
2b	HN-2vskC02	C:188-601

Asymmetric Unit(hide GO term definitions)

Chain A,C (GLYCP_HENDH | O89343)

molecular function
	GO:0004308	exo-alpha-sialidase activity	Catalysis of the hydrolysis of alpha-(2->3)-, alpha-(2->6)-, alpha-(2->8)-glycosidic linkages of terminal sialic residues in oligosaccharides, glycoproteins, glycolipids, colominic acid and synthetic substrates.
	GO:0046789	host cell surface receptor binding	Interacting selectively and non-covalently with a receptor on the host cell surface.
biological process
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
	GO:0019058	viral life cycle	A set of processes which all viruses follow to ensure survival; includes attachment and entry of the virus particle, decoding of genome information, translation of viral mRNA by host ribosomes, genome replication, and assembly and release of viral particles containing the genome.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
	GO:0019062	virion attachment to host cell	The process by which a virion protein binds to molecules on the host cellular surface or host cell surface projection.
cellular component
	GO:0033644	host cell membrane	Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0020002	host cell plasma membrane	The plasma membrane surrounding a host cell.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0019031	viral envelope	The lipid bilayer of a virion that surrounds the protein capsid. May also contain glycoproteins.
	GO:0019012	virion	The complete fully infectious extracellular virus particle.
	GO:0055036	virion membrane	The lipid bilayer surrounding a virion.

Chain B,D (EFNB2_HUMAN | P52799)

molecular function
	GO:0046875	ephrin receptor binding	Interacting selectively and non-covalently with an ephrin receptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0001618	virus receptor activity	Combining with a virus component and mediating entry of the virus into the cell.
biological process
	GO:0031295	T cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
	GO:0009653	anatomical structure morphogenesis	The process in which anatomical structures are generated and organized. Morphogenesis pertains to the creation of form.
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0009887	animal organ morphogenesis	Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
	GO:0007411	axon guidance	The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
	GO:0048514	blood vessel morphogenesis	The process in which the anatomical structures of blood vessels are generated and organized. The blood vessel is the vasculature carrying blood.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0002042	cell migration involved in sprouting angiogenesis	The orderly movement of endothelial cells into the extracellular matrix in order to form new blood vessels involved in sprouting angiogenesis.
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0048013	ephrin receptor signaling pathway	The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
	GO:0001945	lymph vessel development	The process whose specific outcome is the progression of a lymph vessel over time, from its formation to the mature structure.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0010839	negative regulation of keratinocyte proliferation	Any process that decreases the rate, frequency or extent of keratinocyte proliferation. Keratinocyte proliferation is the multiplication or reproduction of keratinocytes, resulting in the expansion of a cell population.
	GO:0072178	nephric duct morphogenesis	The process in which the anatomical structures of the nephric duct are generated and organized. A nephric duct is a tube that drains a primitive kidney.
	GO:0007399	nervous system development	The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
	GO:2000727	positive regulation of cardiac muscle cell differentiation	Any process that activates or increases the frequency, rate or extent of cardiac muscle cell differentiation.
	GO:0050920	regulation of chemotaxis	Any process that modulates the frequency, rate or extent of the directed movement of a motile cell or organism in response to a specific chemical concentration gradient.
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2vsk)

	Sites
(no "Sites" information available for 2vsk)

	Cis Peptide Bonds
		Asp A:473 - Pro A:474	[ RasMol ]
		Asp C:473 - Pro C:474	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2vsk
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	EFNB2_HUMAN \| P52799
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	GLYCP_HENDH \| O89343
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.2.1.18
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	EFNB2_HUMAN \| P52799
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	GLYCP_HENDH \| O89343
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	EFNB2_HUMAN \| P52799	:	2hle 2i85 2vsm 2wo2 3gxu 4uf7
	GLYCP_HENDH \| O89343	:	2x9m

2vsm	NIPAH VIRUS ATTACHMENT GLYCOPROTEIN IN COMPLEX WITH HUMAN CELL SURFACE RECEPTOR EPHRINB2

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (18, 18)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 4)

Exons (3, 6)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (2, 4)

Gene Ontology (38, 42)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File