|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 23)
|
(no "Site" information available for 2DVQ) |
(no "SS Bond" information available for 2DVQ) |
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 2DVQ) |
Asymmetric Unit (3, 8)
|
Asymmetric Unit (4, 11)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:114 aligned with BRD2_HUMAN | P25440 from UniProtKB/Swiss-Prot Length:801 Alignment length:114 82 92 102 112 122 132 142 152 162 172 182 BRD2_HUMAN 73 GRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQE 186 SCOP domains d2dvqa_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) ------------------BROMODOMAIN_2 PDB: A:91-163 UniProt: 91-163 ----------------------- PROSITE (1) PROSITE (2) -----------------------BROMODOMAIN_1 PDB: A:96-155 UniProt: 96-155 ------------------------------- PROSITE (2) Transcript 1 Exon 1.16e PDB: A:73-111 [INCOMPLETE] Exon 1.17 PDB: A:112-157 UniProt: 112-157 Exon 1.18a PDB: A:158-186 Transcript 1 2dvq A 73 GRVTNQLQYLHKVVmKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPmDmGTIKRRLENNYYWAASECmQDFNTmFTNCYIYNKPTDDIVLmAQTLEKIFLQKVASmPQEEQE 186 82 | 92 102 112 122| 132 142 | 152 162 | 172 182 87-MSE 121-MSE 142-MSE | 165-MSE 180-MSE 123-MSE 148-MSE Chain B from PDB Type:PROTEIN Length:112 aligned with BRD2_HUMAN | P25440 from UniProtKB/Swiss-Prot Length:801 Alignment length:112 82 92 102 112 122 132 142 152 162 172 182 BRD2_HUMAN 73 GRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEE 184 SCOP domains d2dvqb_ B: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ------------------BROMODOMAIN_2 PDB: B:91-163 UniProt: 91-163 --------------------- PROSITE (1) PROSITE (2) -----------------------BROMODOMAIN_1 PDB: B:96-155 UniProt: 96-155 ----------------------------- PROSITE (2) Transcript 1 Exon 1.16e PDB: B:73-111 [INCOMPLETE] Exon 1.17 PDB: B:112-157 UniProt: 112-157 Exon 1.18a PDB: B:158-184 Transcript 1 2dvq B 73 GRVTNQLQYLHKVVmKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPmDmGTIKRRLENNYYWAASECmQDFNTmFTNCYIYNKPTDDIVLmAQTLEKIFLQKVASmPQEE 184 82 | 92 102 112 122| 132 142 | 152 162 | 172 182 87-MSE 121-MSE 142-MSE | 165-MSE 180-MSE 123-MSE 148-MSE Chain C from PDB Type:PROTEIN Length:107 aligned with BRD2_HUMAN | P25440 from UniProtKB/Swiss-Prot Length:801 Alignment length:107 85 95 105 115 125 135 145 155 165 175 BRD2_HUMAN 76 TNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQ 182 SCOP domains d2dvqc_ C: automated matches SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---------------BROMODOMAIN_2 PDB: C:91-163 UniProt: 91-163 ------------------- PROSITE (1) PROSITE (2) --------------------BROMODOMAIN_1 PDB: C:96-155 UniProt: 96-155 --------------------------- PROSITE (2) Transcript 1 Exon 1.16e PDB: C:76-111 Exon 1.17 PDB: C:112-157 UniProt: 112-157 Exon 1.18a PDB: C:158-18 Transcript 1 2dvq C 76 TNQLQYLHKVVmKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPmDmGTIKRRLENNYYWAASECmQDFNTmFTNCYIYNKPTDDIVLmAQTLEKIFLQKVASmPQ 182 85 | 95 105 115 | 125 135 |145 | 155 165 175 | 87-MSE 121-MSE 142-MSE | 165-MSE 180-MSE 123-MSE 148-MSE Chain P from PDB Type:PROTEIN Length:8 aligned with H4_YEAST | P02309 from UniProtKB/Swiss-Prot Length:103 Alignment length:8 H4_YEAST 9 KGLGKGGA 16 SCOP domains -------- SCOP domains CATH domains -------- CATH domains Pfam domains -------- Pfam domains SAPs(SNPs) -------- SAPs(SNPs) PROSITE ------HI PROSITE Transcript 2 Exon 2.1 Transcript 2 2dvq P 8 KGLGkGGA 15 | 12-ALY Chain Q from PDB Type:PROTEIN Length:15 aligned with H4_YEAST | P02309 from UniProtKB/Swiss-Prot Length:103 Alignment length:15 11 H4_YEAST 2 SGRGKGGKGLGKGGA 16 SCOP domains --------------- SCOP domains CATH domains --------------- CATH domains Pfam domains --------------- Pfam domains SAPs(SNPs) --------------- SAPs(SNPs) PROSITE -------------HI PROSITE Transcript 2 Exon 2.1 Transcript 2 2dvq Q 1 SGRGKGGKGLGkGGA 15 10 | 12-ALY
|
Asymmetric Unit
|
(no "CATH Domain" information available for 2DVQ) |
(no "Pfam Domain" information available for 2DVQ) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C (BRD2_HUMAN | P25440)
Chain P,Q (H4_YEAST | P02309)
|
|
|
|
|
|
|